Detailed information    

insolico Bioinformatically predicted

Overview

Name   rapC   Type   Regulator
Locus tag   ETA10_RS22705 Genome accession   NZ_CP035397
Coordinates   724950..725177 (-) Length   75 a.a.
NCBI ID   WP_284691249.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103773     
Function   inhibit the DNA-binding function of ComA (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 709884..727661 724950..725177 within 0


Gene organization within MGE regions


Location: 709884..727661
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA10_RS03700 (ETA10_03700) rlmD 709884..711266 (+) 1383 WP_129110459.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  ETA10_RS03705 (ETA10_03705) - 711683..711871 (+) 189 WP_035198876.1 helix-turn-helix domain-containing protein -
  ETA10_RS03710 (ETA10_03710) - 711892..712623 (+) 732 WP_082090360.1 site-specific DNA-methyltransferase -
  ETA10_RS03715 (ETA10_03715) - 712613..713701 (+) 1089 WP_046160152.1 DNA cytosine methyltransferase -
  ETA10_RS03720 (ETA10_03720) - 713688..715907 (+) 2220 WP_046160153.1 AAA family ATPase -
  ETA10_RS03725 (ETA10_03725) - 715904..717364 (+) 1461 WP_046160154.1 LlaJI family restriction endonuclease -
  ETA10_RS22390 - 717382..718422 (+) 1041 WP_206734711.1 hypothetical protein -
  ETA10_RS22395 - 718423..719250 (+) 828 WP_200897643.1 helix-turn-helix transcriptional regulator -
  ETA10_RS03735 (ETA10_03735) - 719711..720544 (+) 834 WP_164907151.1 AbiJ-NTD4 domain-containing protein -
  ETA10_RS03740 (ETA10_03740) - 720840..722279 (+) 1440 WP_129110460.1 hypothetical protein -
  ETA10_RS03745 (ETA10_03745) - 722276..723376 (+) 1101 WP_129110461.1 hypothetical protein -
  ETA10_RS03750 (ETA10_03750) - 723856..724053 (-) 198 WP_129110462.1 hypothetical protein -
  ETA10_RS22700 - 724043..724726 (-) 684 WP_284691248.1 tetratricopeptide repeat protein -
  ETA10_RS22705 rapC 724950..725177 (-) 228 WP_284691249.1 hypothetical protein Regulator
  ETA10_RS03760 (ETA10_03760) - 725358..725662 (-) 305 Protein_681 hypothetical protein -
  ETA10_RS03765 (ETA10_03765) yezA 725729..725935 (-) 207 WP_129110463.1 bacteriocin immunity protein -
  ETA10_RS03770 (ETA10_03770) - 726179..726649 (-) 471 WP_262091302.1 TIGR01741 family protein -
  ETA10_RS03775 (ETA10_03775) - 726728..727198 (-) 471 WP_129110464.1 immunity protein YezG family protein -
  ETA10_RS03780 (ETA10_03780) - 727188..727661 (-) 474 WP_129110465.1 antitoxin YezG family protein -

Sequence

Protein


Download         Length: 75 a.a.        Molecular weight: 8912.11 Da        Isoelectric Point: 4.2933

>NTDB_id=339981 ETA10_RS22705 WP_284691249.1 724950..725177(-) (rapC) [Bacillus subtilis strain SRCM103773]
MRSLGTISSPHVGMEINEWNRHIQKFNVTDAEMLKTEIERDIDIMEEDQDLLLYYQLISFRHQLMIDYVIPSEGN

Nucleotide


Download         Length: 228 bp        

>NTDB_id=339981 ETA10_RS22705 WP_284691249.1 724950..725177(-) (rapC) [Bacillus subtilis strain SRCM103773]
GTGAGGAGTTTAGGCACGATTTCGTCTCCGCACGTTGGAATGGAAATTAATGAGTGGAACCGGCATATTCAAAAGTTTAA
TGTGACTGACGCTGAAATGCTTAAAACTGAGATCGAACGGGACATTGACATCATGGAAGAAGACCAAGACCTCCTGCTTT
ACTATCAGCTCATTTCATTTCGCCATCAGCTTATGATCGACTATGTGATTCCATCTGAAGGAAACTAA

Domains

Predicted by InterproScan.

response regulator aspartate phosphatase H, N terminal (RapH_N)

(6-67)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rapC Bacillus subtilis subsp. subtilis str. 168

54.795

97.333

0.533
  rapF Bacillus subtilis subsp. subtilis str. 168

53.623

92

0.493

Multiple sequence alignment