Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ES968_RS12500 Genome accession   NZ_CP035395
Coordinates   2343242..2343415 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103697     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2338242..2348415
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES968_RS12485 (ES968_12485) gcvT 2339041..2340129 (-) 1089 WP_129134000.1 glycine cleavage system aminomethyltransferase GcvT -
  ES968_RS12490 (ES968_12490) hepAA 2340571..2342244 (+) 1674 WP_014480248.1 SNF2-related protein -
  ES968_RS12495 (ES968_12495) yqhG 2342265..2343059 (+) 795 WP_014480249.1 YqhG family protein -
  ES968_RS12500 (ES968_12500) sinI 2343242..2343415 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ES968_RS12505 (ES968_12505) sinR 2343449..2343784 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ES968_RS12510 (ES968_12510) tasA 2343877..2344662 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ES968_RS12515 (ES968_12515) sipW 2344727..2345299 (-) 573 WP_129134142.1 signal peptidase I SipW -
  ES968_RS12520 (ES968_12520) tapA 2345283..2346044 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ES968_RS12525 (ES968_12525) yqzG 2346316..2346642 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ES968_RS12530 (ES968_12530) spoIITA 2346684..2346863 (-) 180 WP_029726723.1 YqzE family protein -
  ES968_RS12535 (ES968_12535) comGG 2346935..2347309 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ES968_RS12540 (ES968_12540) comGF 2347310..2347693 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  ES968_RS12545 (ES968_12545) comGE 2347719..2348066 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=339861 ES968_RS12500 WP_003230187.1 2343242..2343415(+) (sinI) [Bacillus subtilis strain SRCM103697]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=339861 ES968_RS12500 WP_003230187.1 2343242..2343415(+) (sinI) [Bacillus subtilis strain SRCM103697]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment