Detailed information    

insolico Bioinformatically predicted

Overview

Name   rapC   Type   Regulator
Locus tag   ES965_RS10360 Genome accession   NZ_CP035391
Coordinates   2050202..2051332 (+) Length   376 a.a.
NCBI ID   WP_032725937.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103689     
Function   inhibit the DNA-binding function of ComA (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2007166..2054585 2050202..2051332 within 0


Gene organization within MGE regions


Location: 2007166..2054585
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES965_RS10060 (ES965_10060) - 2007166..2007459 (+) 294 WP_015251960.1 hypothetical protein -
  ES965_RS10065 (ES965_10065) yoaG 2007875..2008279 (-) 405 WP_015714052.1 UPF0715 family protein -
  ES965_RS10070 (ES965_10070) - 2008541..2008663 (+) 123 WP_029318080.1 hypothetical protein -
  ES965_RS10075 (ES965_10075) yozQ 2008717..2009010 (+) 294 WP_015251959.1 YozQ family protein -
  ES965_RS10080 (ES965_10080) yoaH 2009124..2010809 (-) 1686 WP_042975956.1 methyl-accepting chemotaxis protein -
  ES965_RS10085 (ES965_10085) hpaB 2011129..2012580 (+) 1452 WP_024571751.1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component -
  ES965_RS10090 (ES965_10090) exlX 2012617..2013315 (-) 699 WP_003231419.1 expansin ExlX -
  ES965_RS10095 (ES965_10095) yoaK 2013582..2014259 (-) 678 WP_042975966.1 YoaK family protein -
  ES965_RS10100 (ES965_10100) pelB 2014432..2015469 (+) 1038 WP_124058209.1 polysaccharide lyase family 1 protein -
  ES965_RS10105 (ES965_10105) yoaM 2015726..2016409 (+) 684 WP_038829978.1 SOS response-associated peptidase -
  ES965_RS10110 (ES965_10110) - 2016746..2017051 (-) 306 WP_024571746.1 hypothetical protein -
  ES965_RS10115 (ES965_10115) oxdD 2017267..2018445 (-) 1179 WP_124058210.1 oxalate decarboxylase -
  ES965_RS10120 (ES965_10120) yoaO 2018568..2019050 (-) 483 WP_031315569.1 DUF4944 domain-containing protein -
  ES965_RS10125 (ES965_10125) - 2019075..2019230 (-) 156 WP_124058212.1 hypothetical protein -
  ES965_RS21530 - 2019271..2019432 (-) 162 Protein_1929 YoaP domain-containing protein -
  ES965_RS10130 (ES965_10130) - 2019427..2019659 (-) 233 Protein_1930 hypothetical protein -
  ES965_RS10135 (ES965_10135) - 2019764..2020261 (-) 498 WP_129092452.1 hypothetical protein -
  ES965_RS10140 (ES965_10140) yoaR 2020362..2021273 (-) 912 WP_015714063.1 VanW family protein -
  ES965_RS10145 (ES965_10145) yoaS 2021620..2022102 (+) 483 WP_129092453.1 DUF2975 domain-containing protein -
  ES965_RS10150 (ES965_10150) yozG 2022112..2022368 (+) 257 Protein_1934 helix-turn-helix transcriptional regulator -
  ES965_RS10155 (ES965_10155) yoaT 2022474..2023268 (+) 795 WP_064671131.1 DUF817 domain-containing protein -
  ES965_RS10160 (ES965_10160) yoaU 2023377..2024249 (-) 873 WP_124058214.1 LysR family transcriptional regulator -
  ES965_RS10165 (ES965_10165) yoaV 2024350..2025228 (+) 879 WP_124058216.1 DMT family transporter -
  ES965_RS10170 (ES965_10170) - 2025402..2025833 (-) 432 WP_042975982.1 hypothetical protein -
  ES965_RS10175 (ES965_10175) yoaZ 2026100..2026732 (-) 633 WP_124058217.1 type 1 glutamine amidotransferase family protein -
  ES965_RS10180 (ES965_10180) bla 2026996..2027916 (+) 921 WP_116316665.1 class A beta-lactamase -
  ES965_RS10185 (ES965_10185) - 2028211..2028300 (-) 90 Protein_1941 SMI1/KNR4 family protein -
  ES965_RS10190 (ES965_10190) - 2028405..2028755 (-) 351 WP_124058219.1 DUF3221 domain-containing protein -
  ES965_RS21775 (ES965_10195) - 2028918..2029151 (+) 234 WP_124058221.1 hypothetical protein -
  ES965_RS10200 (ES965_10200) - 2029452..2029715 (+) 264 WP_124058223.1 hypothetical protein -
  ES965_RS10205 (ES965_10205) ppsA 2030091..2032691 (-) 2601 WP_124058225.1 phosphoenolpyruvate synthase -
  ES965_RS10210 (ES965_10210) xynA 2033362..2034003 (-) 642 WP_003231377.1 endo-1,4-beta-xylanase XynA -
  ES965_RS10220 (ES965_10220) - 2034686..2034883 (+) 198 Protein_1947 XRE family transcriptional regulator -
  ES965_RS10225 (ES965_10225) - 2034917..2035271 (-) 355 Protein_1948 hypothetical protein -
  ES965_RS10230 (ES965_10230) - 2035692..2036021 (-) 330 WP_124058228.1 HIT domain-containing protein -
  ES965_RS10240 (ES965_10240) - 2036507..2036818 (-) 312 WP_124058910.1 hypothetical protein -
  ES965_RS10245 (ES965_10245) - 2036835..2036964 (-) 130 Protein_1951 hypothetical protein -
  ES965_RS10250 (ES965_10250) - 2036974..2037179 (-) 206 Protein_1952 hypothetical protein -
  ES965_RS10255 (ES965_10255) - 2037183..2037434 (-) 252 WP_029727209.1 hypothetical protein -
  ES965_RS10260 (ES965_10260) - 2037500..2037679 (+) 180 WP_124058912.1 hypothetical protein -
  ES965_RS10265 (ES965_10265) - 2037700..2038617 (-) 918 WP_124058230.1 hypothetical protein -
  ES965_RS10270 (ES965_10270) - 2038778..2039008 (+) 231 WP_029727207.1 membrane protein -
  ES965_RS10275 (ES965_10275) - 2039018..2039410 (-) 393 WP_124058232.1 UPF0715 family protein -
  ES965_RS10280 (ES965_10280) - 2039455..2039676 (-) 222 WP_202412126.1 hypothetical protein -
  ES965_RS10285 (ES965_10285) - 2039710..2040258 (-) 549 WP_029727204.1 hypothetical protein -
  ES965_RS10290 (ES965_10290) - 2040290..2040655 (-) 366 WP_029727203.1 DUF3775 domain-containing protein -
  ES965_RS10295 (ES965_10295) - 2040886..2041689 (-) 804 WP_124058234.1 hypothetical protein -
  ES965_RS10300 (ES965_10300) - 2041816..2042754 (-) 939 WP_142997453.1 cyclic GMP-AMP synthase DncV-like nucleotidyltransferase -
  ES965_RS10305 (ES965_10305) - 2042860..2043087 (-) 228 WP_043857653.1 helix-turn-helix transcriptional regulator -
  ES965_RS10310 (ES965_10310) - 2043177..2044610 (-) 1434 WP_129092454.1 protein kinase -
  ES965_RS10315 (ES965_10315) - 2044994..2045353 (-) 360 WP_124058238.1 hypothetical protein -
  ES965_RS21780 (ES965_10320) - 2045426..2045659 (+) 234 WP_082248634.1 hypothetical protein -
  ES965_RS10325 (ES965_10325) - 2045698..2046219 (-) 522 WP_124058240.1 hypothetical protein -
  ES965_RS10330 (ES965_10330) - 2046758..2047657 (+) 900 WP_124058242.1 S8 family serine peptidase -
  ES965_RS10335 (ES965_10335) - 2047681..2048532 (+) 852 WP_052501876.1 SAR2788 family putative toxin -
  ES965_RS10340 (ES965_10340) - 2048550..2048870 (+) 321 WP_043857657.1 hypothetical protein -
  ES965_RS10345 (ES965_10345) - 2048967..2049173 (-) 207 WP_043857658.1 hypothetical protein -
  ES965_RS10350 (ES965_10350) - 2049244..2049546 (+) 303 Protein_1972 SOS response-associated peptidase -
  ES965_RS21985 (ES965_10355) - 2049922..2050068 (+) 147 Protein_1973 phage holin -
  ES965_RS10360 (ES965_10360) rapC 2050202..2051332 (+) 1131 WP_032725937.1 tetratricopeptide repeat protein Regulator
  ES965_RS21535 - 2051322..2051465 (+) 144 WP_153801665.1 hypothetical protein -
  ES965_RS21790 (ES965_10365) - 2051619..2051819 (-) 201 WP_124058244.1 hypothetical protein -
  ES965_RS21795 - 2052041..2052210 (-) 170 Protein_1977 hypothetical protein -
  ES965_RS10375 (ES965_10375) - 2052208..2052363 (-) 156 Protein_1978 T7SS effector LXG polymorphic toxin -
  ES965_RS10380 (ES965_10380) yobM 2052464..2053021 (-) 558 WP_124058245.1 SMI1/KNR4 family protein -
  ES965_RS10385 (ES965_10385) aoxN 2053149..2054585 (+) 1437 WP_129092455.1 flavin monoamine oxidase family protein -

Sequence

Protein


Download         Length: 376 a.a.        Molecular weight: 44394.15 Da        Isoelectric Point: 5.7041

>NTDB_id=339618 ES965_RS10360 WP_032725937.1 2050202..2051332(+) (rapC) [Bacillus subtilis strain SRCM103689]
MEQLIPSSTVGVKINEWYKYIRMFAVPDAEILKAEVEEEIKHMKEDQDLLLYYSLMCFRHQLMLDYLEPKSLNEERPKIS
DLLEKIESSQTKLKGVLEYYCNFFRGMYEFDKKDYIKAIRSYKIAEKKLALVTDEIERAEFYFKMAEVYYHMKQTHVSMH
YAEAALNIYKDQKTYTVRRIQCAFVVAGNFDDLESHEKAVPHLQRALKDSKAINKHKLIGASLYNLGNCYYKMKEYDKAA
EYIEQAVSLYENDKSDLLPHTLFTLTQIYFKMKDIEKAFILYKKGIEKAQAINDDVLVAEFNYLKALYIDSIDKRTVFRT
FSVLKDNVMYPDLEELALDTANYCKEIGQFENSTTFFDVMVDARIQIQRGECLYEI

Nucleotide


Download         Length: 1131 bp        

>NTDB_id=339618 ES965_RS10360 WP_032725937.1 2050202..2051332(+) (rapC) [Bacillus subtilis strain SRCM103689]
ATGGAGCAATTAATTCCGTCATCCACAGTAGGAGTTAAAATCAATGAGTGGTATAAATACATACGGATGTTCGCCGTTCC
AGATGCAGAGATATTAAAAGCAGAGGTTGAAGAAGAAATAAAACATATGAAGGAAGATCAAGACTTATTGTTGTATTATT
CTCTAATGTGTTTTCGTCATCAGCTAATGCTGGATTACCTTGAACCTAAGTCATTGAATGAAGAACGCCCTAAAATTTCA
GACTTATTAGAAAAGATCGAAAGCAGTCAAACAAAGCTTAAAGGTGTCCTGGAATATTACTGCAATTTCTTTAGAGGAAT
GTACGAATTTGATAAGAAGGATTATATAAAAGCAATAAGGTCATATAAAATTGCTGAGAAAAAGCTCGCTTTAGTAACAG
ACGAAATTGAACGAGCTGAGTTTTATTTCAAAATGGCTGAAGTGTATTATCACATGAAACAAACCCATGTATCAATGCAC
TATGCTGAAGCAGCCCTTAACATTTATAAAGACCAAAAAACTTATACTGTTCGCCGAATACAATGTGCTTTTGTTGTAGC
AGGCAACTTTGATGATCTGGAAAGTCATGAAAAAGCAGTTCCGCATCTTCAAAGAGCATTAAAAGATTCGAAAGCTATAA
ACAAGCACAAACTAATTGGTGCATCGTTATATAATTTGGGGAACTGTTATTATAAGATGAAAGAGTATGACAAAGCTGCT
GAATATATTGAACAAGCAGTCTCATTGTACGAAAACGATAAAAGTGACCTTCTCCCCCACACGTTATTTACACTGACACA
AATTTACTTCAAAATGAAGGATATTGAAAAAGCCTTTATTCTTTATAAAAAAGGAATCGAGAAAGCACAAGCCATAAACG
ATGATGTCTTAGTTGCTGAGTTTAATTACTTAAAGGCTTTATATATCGACTCTATAGATAAACGCACAGTTTTCCGAACT
TTTTCTGTACTTAAAGATAATGTTATGTATCCAGATTTAGAGGAATTAGCACTCGACACGGCTAATTATTGTAAGGAGAT
AGGGCAATTTGAAAACTCAACCACCTTTTTTGACGTTATGGTGGATGCCCGAATCCAAATACAAAGAGGAGAGTGTTTAT
ATGAAATTTAA

Domains

Predicted by InterproScan.

response regulator aspartate phosphatase H, N terminal (RapH_N)

(5-65)

Tetratricopeptide repeat (TPR_12)

(221-287)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rapC Bacillus subtilis subsp. subtilis str. 168

51.064

100

0.511
  rapF Bacillus subtilis subsp. subtilis str. 168

45.119

100

0.455

Multiple sequence alignment