Detailed information    

insolico Bioinformatically predicted

Overview


Name   clpX   Type   Regulator
Locus tag   EQH16_RS07610 Genome accession   NZ_CP035264
Coordinates   1480881..1482113 (-) Length   410 a.a.
NCBI ID   WP_000106346.1    Uniprot ID   A0A064C077
Organism   Streptococcus pneumoniae strain TVO_1901921     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1435358..1491177 1480881..1482113 within 0


Gene organization within MGE regions


Location: 1435358..1491177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH16_RS07285 (EQH16_07660) - 1435358..1436314 (-) 957 WP_238090264.1 N-acetylmuramoyl-L-alanine amidase family protein -
  EQH16_RS07290 (EQH16_07665) - 1436323..1436655 (-) 333 WP_001186203.1 phage holin -
  EQH16_RS07295 (EQH16_07670) - 1436659..1436958 (-) 300 WP_001811580.1 hypothetical protein -
  EQH16_RS07300 (EQH16_07675) - 1436967..1437317 (-) 351 WP_000852245.1 hypothetical protein -
  EQH16_RS07305 (EQH16_07680) - 1437320..1437523 (-) 204 WP_001091118.1 hypothetical protein -
  EQH16_RS11260 - 1437504..1437620 (-) 117 WP_001063633.1 hypothetical protein -
  EQH16_RS07310 - 1437617..1443946 (-) 6330 WP_409202194.1 tail fiber domain-containing protein -
  EQH16_RS07315 (EQH16_07695) - 1445679..1446029 (-) 351 WP_000068020.1 DUF6711 family protein -
  EQH16_RS07320 (EQH16_07700) - 1446038..1449691 (-) 3654 WP_050315488.1 hypothetical protein -
  EQH16_RS07325 (EQH16_07705) - 1449678..1450028 (-) 351 WP_000478010.1 hypothetical protein -
  EQH16_RS07330 (EQH16_07710) - 1450067..1450447 (-) 381 WP_001185635.1 DUF6096 family protein -
  EQH16_RS07335 (EQH16_07715) - 1450452..1450865 (-) 414 WP_000880678.1 phage tail tube protein -
  EQH16_RS07340 (EQH16_07720) - 1450868..1451236 (-) 369 WP_050279221.1 hypothetical protein -
  EQH16_RS07345 (EQH16_07725) - 1451233..1451748 (-) 516 WP_050090558.1 HK97-gp10 family putative phage morphogenesis protein -
  EQH16_RS07350 (EQH16_07730) - 1451723..1452061 (-) 339 WP_000478943.1 hypothetical protein -
  EQH16_RS07355 (EQH16_07735) - 1452042..1452353 (-) 312 WP_000021219.1 phage head-tail connector protein -
  EQH16_RS07360 (EQH16_07740) - 1452355..1452543 (-) 189 WP_000669349.1 hypothetical protein -
  EQH16_RS07365 (EQH16_07745) - 1452533..1452715 (-) 183 WP_000054934.1 Rho termination factor N-terminal domain-containing protein -
  EQH16_RS07370 (EQH16_07750) - 1452727..1453572 (-) 846 WP_000123890.1 N4-gp56 family major capsid protein -
  EQH16_RS07375 (EQH16_07755) - 1453579..1454163 (-) 585 WP_001288024.1 DUF4355 domain-containing protein -
  EQH16_RS07380 (EQH16_07760) - 1454333..1454545 (-) 213 WP_000393349.1 crAss001_48 related protein -
  EQH16_RS07385 - 1454690..1454863 (-) 174 WP_000379086.1 hypothetical protein -
  EQH16_RS07390 (EQH16_07765) - 1455014..1456564 (-) 1551 WP_179127978.1 minor capsid protein -
  EQH16_RS07395 (EQH16_07770) - 1456473..1457942 (-) 1470 WP_000285389.1 phage portal protein -
  EQH16_RS07400 (EQH16_07775) - 1457954..1459252 (-) 1299 WP_050315490.1 PBSX family phage terminase large subunit -
  EQH16_RS07405 (EQH16_07780) - 1459230..1459730 (-) 501 WP_078133928.1 terminase small subunit -
  EQH16_RS07410 (EQH16_07785) - 1460124..1460585 (-) 462 WP_001030245.1 DUF1492 domain-containing protein -
  EQH16_RS07415 (EQH16_07790) - 1460660..1460974 (-) 315 WP_050236431.1 hypothetical protein -
  EQH16_RS07420 (EQH16_07795) - 1460995..1461174 (-) 180 WP_001042650.1 hypothetical protein -
  EQH16_RS11320 (EQH16_07800) - 1461167..1461235 (-) 69 WP_223842487.1 YopX family protein -
  EQH16_RS07425 - 1461235..1461405 (-) 171 WP_168956836.1 hypothetical protein -
  EQH16_RS07430 (EQH16_07805) - 1461398..1461634 (-) 237 WP_050236430.1 DUF3310 domain-containing protein -
  EQH16_RS07435 (EQH16_07810) - 1461655..1462026 (-) 372 WP_050085308.1 hypothetical protein -
  EQH16_RS07440 (EQH16_07815) - 1462023..1462235 (-) 213 WP_000160160.1 hypothetical protein -
  EQH16_RS07445 (EQH16_07820) - 1462236..1462736 (-) 501 WP_001021770.1 DUF1642 domain-containing protein -
  EQH16_RS07450 (EQH16_07825) - 1462738..1463052 (-) 315 WP_050393734.1 hypothetical protein -
  EQH16_RS07455 (EQH16_07830) - 1463315..1463542 (-) 228 WP_226962077.1 hypothetical protein -
  EQH16_RS07460 - 1463542..1463694 (-) 153 WP_000122747.1 hypothetical protein -
  EQH16_RS07465 (EQH16_07835) - 1463988..1465331 (-) 1344 WP_050315477.1 virulence-associated E family protein -
  EQH16_RS07470 (EQH16_07840) - 1465334..1466155 (-) 822 WP_001823578.1 bifunctional DNA primase/polymerase -
  EQH16_RS07475 (EQH16_07845) - 1466328..1466834 (-) 507 WP_000054342.1 hypothetical protein -
  EQH16_RS07480 (EQH16_07850) - 1466854..1467681 (-) 828 WP_000885996.1 AAA family ATPase -
  EQH16_RS07485 (EQH16_07855) - 1467681..1467998 (-) 318 WP_001044592.1 hypothetical protein -
  EQH16_RS07490 (EQH16_07860) - 1468017..1469210 (-) 1194 WP_000028860.1 DEAD/DEAH box helicase family protein -
  EQH16_RS07495 (EQH16_07865) - 1469173..1469658 (-) 486 WP_000696056.1 hypothetical protein -
  EQH16_RS07500 (EQH16_07870) - 1469658..1470008 (-) 351 WP_224757118.1 hypothetical protein -
  EQH16_RS07505 (EQH16_07875) - 1470017..1470499 (-) 483 WP_000157807.1 siphovirus Gp157 family protein -
  EQH16_RS07510 (EQH16_07880) - 1470492..1471214 (-) 723 WP_000544344.1 HNH endonuclease signature motif containing protein -
  EQH16_RS07515 (EQH16_07885) - 1471228..1471458 (-) 231 WP_000252079.1 hypothetical protein -
  EQH16_RS07520 (EQH16_07890) - 1471459..1471800 (-) 342 WP_000189401.1 hypothetical protein -
  EQH16_RS07525 (EQH16_07895) - 1471812..1472003 (-) 192 WP_000970850.1 hypothetical protein -
  EQH16_RS07530 (EQH16_07900) - 1472000..1472194 (-) 195 WP_001050924.1 hypothetical protein -
  EQH16_RS07535 (EQH16_07905) - 1472191..1472463 (-) 273 WP_000388508.1 hypothetical protein -
  EQH16_RS07540 - 1472543..1472686 (-) 144 WP_000389590.1 hypothetical protein -
  EQH16_RS07545 (EQH16_07910) - 1472804..1473025 (+) 222 WP_000041096.1 hypothetical protein -
  EQH16_RS07550 (EQH16_07915) - 1473139..1473330 (-) 192 WP_001112859.1 DNA-binding protein -
  EQH16_RS07555 (EQH16_07920) - 1473395..1473634 (+) 240 WP_000142893.1 hypothetical protein -
  EQH16_RS07560 (EQH16_07925) - 1474052..1474405 (+) 354 WP_000493110.1 helix-turn-helix domain-containing protein -
  EQH16_RS07565 (EQH16_07930) - 1474407..1474829 (+) 423 WP_000181886.1 hypothetical protein -
  EQH16_RS07570 (EQH16_07935) - 1474833..1475312 (+) 480 WP_001113481.1 hypothetical protein -
  EQH16_RS07575 (EQH16_07940) - 1475333..1475713 (+) 381 WP_000151193.1 ImmA/IrrE family metallo-endopeptidase -
  EQH16_RS07580 (EQH16_07945) - 1475855..1476982 (+) 1128 WP_000266847.1 site-specific integrase -
  EQH16_RS07585 (EQH16_07950) whiA 1477070..1477981 (-) 912 WP_000011306.1 DNA-binding protein WhiA -
  EQH16_RS07590 (EQH16_07955) - 1477978..1478955 (-) 978 WP_001231067.1 YvcK family protein -
  EQH16_RS07595 (EQH16_07960) rapZ 1478952..1479842 (-) 891 WP_000163035.1 RNase adapter RapZ -
  EQH16_RS07600 (EQH16_07965) - 1479894..1480274 (-) 381 WP_001140412.1 RidA family protein -
  EQH16_RS07605 (EQH16_07970) yihA 1480285..1480872 (-) 588 WP_000422599.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  EQH16_RS07610 (EQH16_07975) clpX 1480881..1482113 (-) 1233 WP_000106346.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  EQH16_RS07615 (EQH16_07980) - 1482145..1482315 (-) 171 WP_000442275.1 hypothetical protein -
  EQH16_RS07620 (EQH16_07985) - 1482315..1482821 (-) 507 WP_000162486.1 dihydrofolate reductase -
  EQH16_RS07625 (EQH16_07990) - 1482951..1483469 (-) 519 WP_000229874.1 DNA starvation/stationary phase protection protein -
  EQH16_RS07630 (EQH16_07995) lytC 1483965..1485469 (-) 1505 Protein_1534 choline binding-anchored murein hydrolase LytC -
  EQH16_RS07635 (EQH16_08000) tpiA 1485507..1486265 (-) 759 WP_000087897.1 triose-phosphate isomerase -
  EQH16_RS07640 (EQH16_08005) - 1486363..1487040 (-) 678 WP_000221604.1 DnaD domain-containing protein -
  EQH16_RS07645 (EQH16_08010) metA 1487049..1487993 (-) 945 WP_001122713.1 homoserine O-succinyltransferase -
  EQH16_RS07650 (EQH16_08015) - 1488188..1488700 (-) 513 WP_001049325.1 adenine phosphoribosyltransferase -
  EQH16_RS07655 (EQH16_08020) - 1488788..1489546 (-) 759 WP_001287230.1 class I SAM-dependent methyltransferase -
  EQH16_RS07660 - 1489754..1489900 (+) 147 WP_000403100.1 hypothetical protein -
  EQH16_RS07665 (EQH16_08025) - 1490047..1491177 (-) 1131 WP_000229959.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 410 a.a.        Molecular weight: 45798.35 Da        Isoelectric Point: 4.4550

>NTDB_id=338623 EQH16_RS07610 WP_000106346.1 1480881..1482113(-) (clpX) [Streptococcus pneumoniae strain TVO_1901921]
MSTNRKNDMMVYCSFCGKNQEEVQKIIAGNNAFICNECVELAQEIIREELVEEVLADLSEVPKPIELLHILNHYVIGQDR
AKRALAVAVYNHYKRINFHDTREESEDVDLQKSNILMIGPTGSGKTFLAQTLAKSLNVPFAIADATALTEAGYVGEDVEN
ILLKLLQVADFNIERAERGIIYVDEIDKIAKKSENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEMIQVDT
KNILFIVGGAFDGIEEIVKQRLGEKVIGFGQNNKAIDENSSYMQEIIAEDIQKFGIIPELIGRLPVFAALEQLTVDDLVR
ILKEPRNALVKQYQTLLSYDDVELEFDDEALQEIANKAIERKTGARGLRSIIEETMLDVMFEVPSQENVKLVRITKETVD
GTDKPILETA

Nucleotide


Download         Length: 1233 bp        

>NTDB_id=338623 EQH16_RS07610 WP_000106346.1 1480881..1482113(-) (clpX) [Streptococcus pneumoniae strain TVO_1901921]
ATGTCTACAAATAGAAAAAATGATATGATGGTTTATTGCTCATTTTGTGGCAAAAACCAAGAAGAAGTACAAAAAATAAT
TGCTGGCAACAATGCTTTTATTTGTAATGAATGCGTGGAGTTAGCTCAGGAAATCATTCGAGAAGAATTGGTTGAGGAAG
TCTTGGCAGACTTGTCTGAGGTGCCAAAACCAATTGAACTCCTCCATATCTTGAACCACTATGTAATTGGTCAAGATCGT
GCCAAGCGTGCCTTGGCAGTGGCGGTTTATAACCACTACAAACGCATCAATTTCCACGATACACGCGAAGAGTCAGAAGA
TGTGGATTTGCAGAAGTCAAACATTTTGATGATTGGCCCAACTGGTTCAGGGAAAACTTTCCTTGCCCAGACCTTGGCTA
AGAGCTTGAATGTGCCTTTTGCTATTGCGGATGCGACAGCTCTGACGGAGGCTGGTTATGTGGGTGAGGACGTGGAAAAT
ATCCTCCTCAAACTCTTGCAGGTTGCTGACTTTAACATCGAACGTGCAGAGCGTGGCATTATCTATGTGGATGAAATTGA
CAAGATTGCCAAGAAGAGTGAGAATGTGTCTATCACACGTGATGTTTCTGGTGAAGGGGTGCAACAAGCCCTTCTCAAGA
TTATCGAGGGAACTGTTGCTAGCGTGCCGCCTCAAGGTGGACGCAAACATCCACAACAAGAGATGATTCAAGTGGATACA
AAAAATATCCTCTTCATCGTGGGTGGTGCTTTTGATGGTATTGAAGAAATTGTCAAACAACGTCTGGGTGAAAAAGTCAT
CGGATTTGGTCAAAATAATAAGGCGATTGACGAAAACAGCTCATATATGCAAGAAATCATCGCTGAAGACATTCAAAAAT
TTGGTATTATCCCTGAGTTGATTGGACGCTTGCCTGTTTTTGCGGCTCTTGAGCAATTGACCGTTGATGACTTGGTTCGC
ATCTTGAAAGAGCCAAGAAATGCCTTGGTGAAACAATACCAAACTTTGCTTTCTTATGATGATGTTGAGTTGGAATTTGA
CGACGAAGCCCTTCAAGAGATTGCTAATAAAGCAATCGAACGGAAGACAGGGGCGCGTGGACTTCGCTCCATTATCGAAG
AAACCATGCTAGATGTTATGTTTGAGGTGCCGAGTCAGGAAAATGTGAAATTGGTTCGCATCACTAAAGAAACTGTCGAT
GGAACGGATAAACCGATCCTAGAAACAGCCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A064C077

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  clpX Streptococcus mutans UA159

86.585

100

0.866

  clpX Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819

57.214

98.049

0.561


Multiple sequence alignment