Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH17_RS02405 Genome accession   NZ_CP035263
Coordinates   485384..485533 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae strain TVO_1901922     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 483660..484465 485384..485533 flank 919


Gene organization within MGE regions


Location: 483660..485533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH17_RS02390 (EQH17_02580) - 483660..484465 (+) 806 Protein_478 IS5 family transposase -
  EQH17_RS02395 (EQH17_02585) blpM 484667..484921 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQH17_RS02400 (EQH17_02590) blpN 484937..485140 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQH17_RS02405 (EQH17_02600) cipB 485384..485533 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=338524 EQH17_RS02405 WP_001813641.1 485384..485533(+) (cipB) [Streptococcus pneumoniae strain TVO_1901922]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=338524 EQH17_RS02405 WP_001813641.1 485384..485533(+) (cipB) [Streptococcus pneumoniae strain TVO_1901922]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment