Detailed information NTG0337899

Bioinformatically predicted

Overview

• Name: HI0659
• Type: Machinery gene
• Locus tag: EQH26_RS02980
• Genome accession: NZ_CP035254
• Coordinates: 577460..577726 (+)
• Length: 88 a.a.
• NCBI ID: WP_001821962.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain TVO_1901932
• Function: DNA uptake (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	554731..576632	577460..577726	flank	828
IScluster/Tn	576887..577382	577460..577726	flank	78

Gene organization within MGE regions

Location: 554731..577726

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EQH26_RS02890 (EQH26_03090)	-	554731..556956 (+)	2226	WP_000665366.1	ATP-binding protein	-
EQH26_RS02895 (EQH26_03095)	-	556959..557585 (+)	627	WP_000199861.1	hypothetical protein	-
EQH26_RS02900 (EQH26_03100)	-	557578..558213 (+)	636	WP_000460949.1	HNH endonuclease	-
EQH26_RS02905 (EQH26_03105)	-	558256..559476 (+)	1221	WP_000185419.1	DNA cytosine methyltransferase	-
EQH26_RS02910	-	559547..561124 (+)	1578	WP_000265462.1	hypothetical protein	-
EQH26_RS02915	-	561227..562492 (+)	1266	WP_001821955.1	TOTE conflict system archaeo-eukaryotic primase domain-containing protein	-
EQH26_RS02920	-	562504..563904 (+)	1401	WP_225349736.1	DEAD/DEAH box helicase	-
EQH26_RS02925 (EQH26_03120)	licT	564204..565043 (+)	840	WP_000584536.1	BglG family transcription antiterminator LicT	-
EQH26_RS02930 (EQH26_03125)	-	565061..566899 (+)	1839	WP_000120557.1	beta-glucoside-specific PTS transporter subunit IIABC	-
EQH26_RS02935 (EQH26_03130)	-	566912..568327 (+)	1416	WP_000151827.1	glycoside hydrolase family 1 protein	-
EQH26_RS02940 (EQH26_03135)	pheS	568919..569965 (+)	1047	WP_001821957.1	phenylalanine--tRNA ligase subunit alpha	-
EQH26_RS02945 (EQH26_03140)	-	569965..570474 (+)	510	WP_000619941.1	N-acetyltransferase	-
EQH26_RS02950 (EQH26_03145)	pheT	570551..572956 (+)	2406	WP_000961512.1	phenylalanine--tRNA ligase subunit beta	-
EQH26_RS02955 (EQH26_03150)	-	573024..574028 (-)	1005	WP_000491760.1	endonuclease/exonuclease/phosphatase family protein	-
EQH26_RS02960 (EQH26_03155)	-	574049..574732 (-)	684	WP_000743644.1	DUF6973 domain-containing protein	-
EQH26_RS02965 (EQH26_03160)	-	575004..575513 (-)	510	WP_001066470.1	hypothetical protein	-
EQH26_RS02970 (EQH26_03165)	-	575751..576632 (+)	882	WP_001267157.1	helix-turn-helix transcriptional regulator	-
EQH26_RS02975 (EQH26_03170)	-	576887..577376 (+)	490	Protein_596	transposase	-
EQH26_RS02980 (EQH26_03175)	HI0659	577460..577726 (+)	267	WP_001821962.1	helix-turn-helix domain-containing protein	Machinery gene

Sequence

Protein

• Length: 88 a.a.
• Molecular weight: 9615.21 Da
• Isoelectric Point: 5.1633

>NTDB_id=337899 EQH26_RS02980 WP_001821962.1 577460..577726(+) (HI0659) [Streptococcus pneumoniae strain TVO_1901932]
MEGCPSELFSKEEILESDMRVAIMSELIEARNKQGISQKKLEEVSGVSQPVIARMETGKTSPQLDTVLKVLASLGKILAV
VRLEQGKS

Nucleotide

• Length: 267 bp

>NTDB_id=337899 EQH26_RS02980 WP_001821962.1 577460..577726(+) (HI0659) [Streptococcus pneumoniae strain TVO_1901932]
TTGGAAGGATGTCCATCTGAGCTCTTTAGCAAGGAGGAAATCCTTGAAAGTGATATGCGAGTAGCTATCATGAGCGAGTT
GATTGAAGCCAGAAATAAGCAAGGAATCAGTCAGAAAAAGCTAGAGGAAGTCAGTGGAGTGAGTCAGCCTGTTATAGCTA
GGATGGAGACAGGTAAGACTAGTCCACAGTTGGACACAGTCTTAAAAGTCCTAGCTAGTCTAGGAAAGATACTAGCAGTC
GTCCGACTTGAACAGGGGAAAAGTTGA

Domains

Predicted by InterproScan.

• Helix-turn-helix (HTH_3) (28-75)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
HI0659	Haemophilus influenzae Rd KW20	58.442	87.5	0.511