Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH28_RS02460 Genome accession   NZ_CP035252
Coordinates   480708..480857 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain TVO_1901934     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 475708..485857
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH28_RS02440 (EQH28_02600) comA/nlmT 476775..478451 (-) 1677 WP_196300924.1 peptide cleavage/export ABC transporter Regulator
  EQH28_RS11265 comA/nlmT 478345..478932 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQH28_RS02445 (EQH28_02605) blpI 479214..479411 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  EQH28_RS02450 (EQH28_02615) blpJ 479878..480147 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  EQH28_RS02455 (EQH28_02620) blpK 480216..480464 (+) 249 WP_047475057.1 bacteriocin-like peptide BlpK -
  EQH28_RS02460 (EQH28_02630) cipB 480708..480857 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  EQH28_RS11370 - 480893..480958 (+) 66 Protein_490 ComC/BlpC family peptide pheromone/bacteriocin -
  EQH28_RS02465 (EQH28_02635) - 480961..481080 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQH28_RS02470 (EQH28_02645) - 481561..481919 (+) 359 Protein_492 immunity protein -
  EQH28_RS02475 (EQH28_02655) - 482548..482931 (+) 384 WP_000877381.1 hypothetical protein -
  EQH28_RS02480 (EQH28_02660) - 482983..483672 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  EQH28_RS02485 (EQH28_02665) blpZ 483714..483947 (+) 234 WP_000276498.1 immunity protein BlpZ -
  EQH28_RS02490 (EQH28_02675) - 484098..484709 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  EQH28_RS02495 (EQH28_02680) ccrZ 484870..485664 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=337815 EQH28_RS02460 WP_001809846.1 480708..480857(+) (cipB) [Streptococcus pneumoniae strain TVO_1901934]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=337815 EQH28_RS02460 WP_001809846.1 480708..480857(+) (cipB) [Streptococcus pneumoniae strain TVO_1901934]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment