Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH32_RS02620 Genome accession   NZ_CP035248
Coordinates   512377..512526 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_1901939     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 510706..511510 512377..512526 flank 867


Gene organization within MGE regions


Location: 510706..512526
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH32_RS02605 (EQH32_02760) - 510706..511510 (+) 805 WP_001105180.1 IS5 family transposase -
  EQH32_RS02610 (EQH32_02765) blpM 511660..511914 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQH32_RS02615 (EQH32_02770) blpN 511930..512133 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQH32_RS02620 (EQH32_02780) cipB 512377..512526 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=337578 EQH32_RS02620 WP_001818346.1 512377..512526(+) (cipB) [Streptococcus pneumoniae strain TVO_1901939]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=337578 EQH32_RS02620 WP_001818346.1 512377..512526(+) (cipB) [Streptococcus pneumoniae strain TVO_1901939]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment