Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   EQH41_RS05350 Genome accession   NZ_CP035239
Coordinates   1071900..1072193 (+) Length   97 a.a.
NCBI ID   WP_000794247.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_TIGR4     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1063491..1084033 1071900..1072193 within 0


Gene organization within MGE regions


Location: 1063491..1084033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH41_RS05280 (EQH41_05620) - 1063491..1064654 (-) 1164 WP_001021837.1 site-specific integrase -
  EQH41_RS05285 (EQH41_05625) - 1064729..1065577 (-) 849 WP_000700645.1 helix-turn-helix domain-containing protein -
  EQH41_RS11040 (EQH41_05630) - 1065697..1066050 (+) 354 WP_000032304.1 helix-turn-helix transcriptional regulator -
  EQH41_RS05295 (EQH41_05635) - 1066150..1066416 (+) 267 WP_000404762.1 hypothetical protein -
  EQH41_RS05300 - 1066427..1066579 (+) 153 WP_000706985.1 hypothetical protein -
  EQH41_RS05305 (EQH41_05640) - 1066784..1067401 (+) 618 WP_000424676.1 Rha family transcriptional regulator -
  EQH41_RS05310 (EQH41_05645) - 1067436..1067888 (+) 453 WP_000141102.1 hypothetical protein -
  EQH41_RS05315 (EQH41_05650) - 1067885..1068331 (+) 447 WP_000171242.1 DnaD domain protein -
  EQH41_RS05320 (EQH41_05655) - 1068343..1069227 (+) 885 WP_000838905.1 ATP-binding protein -
  EQH41_RS05325 (EQH41_05660) - 1069476..1070126 (+) 651 WP_000138311.1 hypothetical protein -
  EQH41_RS05330 (EQH41_05665) - 1070173..1070601 (+) 429 WP_000918210.1 hypothetical protein -
  EQH41_RS05335 (EQH41_05670) - 1070609..1070920 (+) 312 WP_001113833.1 hypothetical protein -
  EQH41_RS05340 (EQH41_05675) - 1070938..1071348 (+) 411 WP_000162610.1 hypothetical protein -
  EQH41_RS05345 (EQH41_05680) - 1071545..1071910 (+) 366 WP_000551587.1 type II toxin-antitoxin system RelE/ParE family toxin -
  EQH41_RS05350 (EQH41_05685) HI0659 1071900..1072193 (+) 294 WP_000794247.1 helix-turn-helix domain-containing protein Machinery gene
  EQH41_RS05355 (EQH41_05690) - 1072211..1073401 (+) 1191 WP_000123149.1 hypothetical protein -
  EQH41_RS05360 - 1073404..1073580 (+) 177 WP_000346914.1 hypothetical protein -
  EQH41_RS05365 (EQH41_05695) - 1073900..1074346 (-) 447 WP_061631657.1 tyrosine-type recombinase/integrase -
  EQH41_RS05370 (EQH41_05700) - 1074246..1075091 (-) 846 Protein_1079 IS630 family transposase -
  EQH41_RS05375 (EQH41_05710) - 1075262..1075417 (+) 156 Protein_1080 diacylglycerol kinase family lipid kinase -
  EQH41_RS05380 (EQH41_05715) rexB 1075617..1078892 (+) 3276 WP_000772372.1 ATP-dependent nuclease subunit B -
  EQH41_RS05385 (EQH41_05720) addA 1078889..1082539 (+) 3651 WP_000767212.1 helicase-exonuclease AddAB subunit AddA -
  EQH41_RS05390 (EQH41_05730) - 1082754..1083932 (+) 1179 WP_000174755.1 hypothetical protein -

Sequence

Protein


Download         Length: 97 a.a.        Molecular weight: 10751.45 Da        Isoelectric Point: 5.1991

>NTDB_id=336968 EQH41_RS05350 WP_000794247.1 1071900..1072193(+) (HI0659) [Streptococcus pneumoniae strain TVO_TIGR4]
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEHEQV

Nucleotide


Download         Length: 294 bp        

>NTDB_id=336968 EQH41_RS05350 WP_000794247.1 1071900..1072193(+) (HI0659) [Streptococcus pneumoniae strain TVO_TIGR4]
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAGGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGAAATGAAAAGGGTATTAGTCAGAAGAAACTAGAGGAGATGA
GCGGTGTTAGTCAGCCAGTTATCGCTAGAATGGAAACAGGAAAGACAAGCCCACAACTTGATACAGTATTAAAAGTGTTG
GCAAGTCTTGGTAAGACCTTAGCTGTTGTACCATTAGAGCATGAGCAGGTTTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

57.143

93.814

0.536

Multiple sequence alignment