Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   BBR47_RS10025 Genome accession   NC_012491
Coordinates   2038089..2038517 (-) Length   142 a.a.
NCBI ID   WP_012685661.1    Uniprot ID   C0ZAW6
Organism   Brevibacillus brevis NBRC 100599     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2025146..2037576 2038089..2038517 flank 513


Gene organization within MGE regions


Location: 2025146..2038517
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BBR47_RS09935 (BBR47_19300) - 2025146..2026645 (+) 1500 WP_012685644.1 recombinase family protein -
  BBR47_RS09940 (BBR47_19310) - 2026679..2027053 (+) 375 Protein_1899 sigma-70 family RNA polymerase sigma factor -
  BBR47_RS09945 (BBR47_19320) - 2027200..2027394 (-) 195 WP_012685646.1 tautomerase family protein -
  BBR47_RS30825 (BBR47_19330) - 2027516..2027668 (+) 153 WP_155801079.1 hypothetical protein -
  BBR47_RS09950 (BBR47_19340) - 2027892..2028359 (-) 468 WP_012685648.1 hypothetical protein -
  BBR47_RS31215 (BBR47_19350) - 2028484..2028630 (+) 147 WP_012685649.1 hypothetical protein -
  BBR47_RS09955 (BBR47_19360) - 2028939..2029385 (+) 447 WP_012685650.1 ASCH domain-containing protein -
  BBR47_RS09960 - 2029369..2029719 (+) 351 WP_041749346.1 YopX family protein -
  BBR47_RS09965 (BBR47_19370) - 2029754..2031085 (-) 1332 WP_012684240.1 IS3 family transposase -
  BBR47_RS31940 - 2031200..2031274 (+) 75 WP_155801118.1 YopX family protein -
  BBR47_RS09970 (BBR47_19380) - 2031302..2031607 (-) 306 WP_041749347.1 recombinase family protein -
  BBR47_RS09975 (BBR47_19390) - 2031736..2032128 (+) 393 WP_012685652.1 ArpU family phage packaging/lysis transcriptional regulator -
  BBR47_RS09980 (BBR47_19400) - 2032169..2032615 (-) 447 WP_012685653.1 replication/maintenance protein RepL -
  BBR47_RS09985 - 2032859..2033068 (+) 210 WP_041749348.1 hypothetical protein -
  BBR47_RS09990 - 2033806..2034057 (+) 252 WP_041749349.1 hypothetical protein -
  BBR47_RS09995 (BBR47_19420) - 2034260..2034748 (-) 489 WP_041749350.1 hypothetical protein -
  BBR47_RS29740 - 2034939..2035265 (+) 327 WP_231850581.1 hypothetical protein -
  BBR47_RS10005 (BBR47_19440) - 2035652..2036947 (+) 1296 WP_012685657.1 site-specific DNA-methyltransferase -
  BBR47_RS10015 (BBR47_19460) - 2037340..2037576 (+) 237 WP_012685659.1 hypothetical protein -
  BBR47_RS10020 (BBR47_19470) - 2037610..2037966 (+) 357 WP_012685660.1 hypothetical protein -
  BBR47_RS10025 (BBR47_19480) nucA/comI 2038089..2038517 (-) 429 WP_012685661.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 142 a.a.        Molecular weight: 15493.71 Da        Isoelectric Point: 7.8698

>NTDB_id=33687 BBR47_RS10025 WP_012685661.1 2038089..2038517(-) (nucA/comI) [Brevibacillus brevis NBRC 100599]
MTQKKILMLIVVLLIGAAYFFGLVPKENKPVNNGNVDHTIVFPSDRYPQTAKHIKEAIASGKSAVCTIDRSGADGNREKS
LKGIPTKKGYDRDEWPMAMCAEGGTGAHIEYISPSDNRGAGSWISNQLEDYPDGTKVEILVK

Nucleotide


Download         Length: 429 bp        

>NTDB_id=33687 BBR47_RS10025 WP_012685661.1 2038089..2038517(-) (nucA/comI) [Brevibacillus brevis NBRC 100599]
ATGACACAGAAAAAAATCCTGATGTTGATTGTGGTGCTGCTGATCGGCGCAGCCTATTTCTTTGGACTTGTGCCAAAAGA
GAACAAACCAGTCAACAACGGGAACGTAGACCATACGATTGTTTTTCCGTCTGATCGATACCCTCAGACCGCAAAGCATA
TCAAAGAAGCGATTGCCTCTGGGAAGTCAGCTGTATGTACAATTGACCGCAGTGGGGCAGATGGAAATCGCGAAAAATCA
CTCAAAGGTATTCCTACAAAAAAGGGATATGATCGAGATGAATGGCCAATGGCTATGTGTGCTGAGGGAGGCACAGGGGC
ACATATTGAATACATATCACCTTCAGATAATCGAGGGGCTGGATCGTGGATTTCCAATCAACTAGAGGATTATCCCGACG
GAACCAAGGTTGAAATCTTGGTCAAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(45-140)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB C0ZAW6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

60.465

90.845

0.549

Multiple sequence alignment