Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH44_RS02550 | Genome accession | NZ_CP035236 |
| Coordinates | 507865..508014 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain TVO_1902282 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 502865..513014
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH44_RS02525 (EQH44_02720) | blpC | 503159..503314 (-) | 156 | WP_000358817.1 | quorum-sensing system pheromone BlpC | - |
| EQH44_RS02530 (EQH44_02725) | - | 503371..504732 (-) | 1362 | WP_001069082.1 | bacteriocin secretion accessory protein | - |
| EQH44_RS02535 (EQH44_02730) | blpA | 504743..506868 (-) | 2126 | Protein_508 | peptide cleavage/export ABC transporter BlpA | - |
| EQH44_RS02540 (EQH44_02735) | blpM | 507148..507402 (+) | 255 | WP_001093257.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH44_RS02545 (EQH44_02740) | blpN | 507418..507621 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH44_RS02550 (EQH44_02750) | cipB | 507865..508014 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH44_RS02555 (EQH44_02755) | - | 508118..508237 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH44_RS02560 (EQH44_02760) | - | 508535..508696 (+) | 162 | WP_000727120.1 | hypothetical protein | - |
| EQH44_RS02565 (EQH44_02765) | - | 508706..509077 (+) | 372 | WP_001812219.1 | hypothetical protein | - |
| EQH44_RS02570 (EQH44_02775) | - | 509706..510089 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| EQH44_RS02575 (EQH44_02780) | - | 510141..510830 (+) | 690 | WP_000760525.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH44_RS02580 (EQH44_02785) | blpZ | 510872..511120 (+) | 249 | WP_000276502.1 | immunity protein BlpZ | - |
| EQH44_RS02585 (EQH44_02790) | - | 511150..511761 (+) | 612 | WP_000394027.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH44_RS02590 (EQH44_02795) | ccrZ | 511923..512717 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=336730 EQH44_RS02550 WP_001809846.1 507865..508014(+) (cipB) [Streptococcus pneumoniae strain TVO_1902282]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=336730 EQH44_RS02550 WP_001809846.1 507865..508014(+) (cipB) [Streptococcus pneumoniae strain TVO_1902282]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |