Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH45_RS02715 Genome accession   NZ_CP035235
Coordinates   536109..536258 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain TVO_1902276     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 534438..535242 536109..536258 flank 867


Gene organization within MGE regions


Location: 534438..536258
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH45_RS02700 (EQH45_02870) - 534438..535242 (+) 805 WP_128903587.1 IS5 family transposase -
  EQH45_RS02705 (EQH45_02875) blpM 535392..535646 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQH45_RS02710 (EQH45_02880) blpN 535662..535865 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQH45_RS02715 (EQH45_02890) cipB 536109..536258 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=336654 EQH45_RS02715 WP_001818346.1 536109..536258(+) (cipB) [Streptococcus pneumoniae strain TVO_1902276]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=336654 EQH45_RS02715 WP_001818346.1 536109..536258(+) (cipB) [Streptococcus pneumoniae strain TVO_1902276]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment