Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EQZ20_RS20485 Genome accession   NZ_CP035232
Coordinates   3950298..3950582 (-) Length   94 a.a.
NCBI ID   WP_046129133.1    Uniprot ID   -
Organism   Bacillus glycinifermentans strain SRCM103574     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3909484..3960847 3950298..3950582 within 0


Gene organization within MGE regions


Location: 3909484..3960847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQZ20_RS20220 (EQZ20_20220) - 3909484..3909702 (-) 219 WP_046129177.1 transcriptional regulator -
  EQZ20_RS20225 (EQZ20_20225) - 3909929..3910498 (+) 570 WP_046129176.1 hypothetical protein -
  EQZ20_RS25650 - 3910744..3910998 (-) 255 Protein_4027 peptidoglycan-binding domain-containing protein -
  EQZ20_RS25655 (EQZ20_20230) - 3911110..3911823 (-) 714 Protein_4028 N-acetylmuramoyl-L-alanine amidase -
  EQZ20_RS20235 (EQZ20_20235) - 3911875..3912138 (-) 264 WP_046129174.1 phage holin -
  EQZ20_RS20240 (EQZ20_20240) - 3912154..3912423 (-) 270 WP_046129173.1 hemolysin XhlA family protein -
  EQZ20_RS20245 (EQZ20_20245) - 3912498..3914111 (-) 1614 WP_046129172.1 phage baseplate upper protein -
  EQZ20_RS20250 (EQZ20_20250) - 3914124..3916691 (-) 2568 WP_046129171.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  EQZ20_RS20255 (EQZ20_20255) - 3916710..3918587 (-) 1878 WP_231947513.1 prophage endopeptidase tail family protein -
  EQZ20_RS20260 (EQZ20_20260) - 3918611..3919438 (-) 828 WP_046129169.1 phage tail domain-containing protein -
  EQZ20_RS20265 (EQZ20_20265) - 3919435..3923754 (-) 4320 WP_065894691.1 phage tail tape measure protein -
  EQZ20_RS20270 (EQZ20_20270) - 3923958..3924320 (-) 363 WP_043054118.1 hypothetical protein -
  EQZ20_RS20275 (EQZ20_20275) - 3924320..3924952 (-) 633 WP_046129168.1 major tail protein -
  EQZ20_RS20280 (EQZ20_20280) - 3924952..3925332 (-) 381 WP_046129167.1 DUF3168 domain-containing protein -
  EQZ20_RS20285 (EQZ20_20285) - 3925329..3925742 (-) 414 WP_052948491.1 HK97-gp10 family putative phage morphogenesis protein -
  EQZ20_RS20290 (EQZ20_20290) - 3925720..3926076 (-) 357 WP_082094020.1 phage head closure protein -
  EQZ20_RS20295 (EQZ20_20295) - 3926039..3926329 (-) 291 WP_046129165.1 head-tail connector protein -
  EQZ20_RS20300 (EQZ20_20300) - 3926307..3927608 (-) 1302 WP_046129164.1 phage major capsid protein -
  EQZ20_RS20305 (EQZ20_20305) - 3927605..3928195 (-) 591 WP_046129163.1 HK97 family phage prohead protease -
  EQZ20_RS20310 (EQZ20_20310) - 3928188..3929366 (-) 1179 WP_046129162.1 phage portal protein -
  EQZ20_RS20315 (EQZ20_20315) - 3929379..3931133 (-) 1755 WP_099047075.1 terminase TerL endonuclease subunit -
  EQZ20_RS20320 (EQZ20_20320) - 3931130..3931534 (-) 405 WP_043054550.1 P27 family phage terminase small subunit -
  EQZ20_RS20325 (EQZ20_20325) - 3931612..3931983 (-) 372 WP_046129161.1 HNH endonuclease signature motif containing protein -
  EQZ20_RS20330 (EQZ20_20330) - 3931980..3932189 (-) 210 WP_046129160.1 hypothetical protein -
  EQZ20_RS20335 (EQZ20_20335) - 3932495..3933124 (-) 630 WP_046129159.1 hypothetical protein -
  EQZ20_RS20340 (EQZ20_20340) - 3933112..3933357 (-) 246 WP_046129158.1 hypothetical protein -
  EQZ20_RS20345 (EQZ20_20345) - 3933360..3933584 (-) 225 WP_046129157.1 hypothetical protein -
  EQZ20_RS20350 (EQZ20_20350) - 3933946..3934128 (+) 183 WP_043054107.1 type II toxin-antitoxin system HicA family toxin -
  EQZ20_RS20355 (EQZ20_20355) - 3934177..3934593 (+) 417 WP_046129156.1 type II toxin-antitoxin system HicB family antitoxin -
  EQZ20_RS25160 - 3934723..3934878 (-) 156 WP_164918132.1 hypothetical protein -
  EQZ20_RS20360 (EQZ20_20360) - 3935098..3935640 (-) 543 WP_046129154.1 site-specific integrase -
  EQZ20_RS20365 (EQZ20_20365) - 3935640..3936080 (-) 441 WP_046129153.1 ArpU family phage packaging/lysis transcriptional regulator -
  EQZ20_RS25660 - 3936096..3936224 (-) 129 WP_099047076.1 hypothetical protein -
  EQZ20_RS25855 - 3936339..3936473 (-) 135 WP_269081994.1 hypothetical protein -
  EQZ20_RS20370 (EQZ20_20370) - 3936507..3937316 (-) 810 WP_046129152.1 DNA adenine methylase -
  EQZ20_RS20375 (EQZ20_20375) - 3937390..3937641 (-) 252 WP_046129151.1 hypothetical protein -
  EQZ20_RS20380 (EQZ20_20380) - 3937638..3937871 (-) 234 WP_046129150.1 hypothetical protein -
  EQZ20_RS20385 (EQZ20_20385) - 3937906..3938112 (-) 207 WP_046129149.1 XtrA/YqaO family protein -
  EQZ20_RS20390 (EQZ20_20390) - 3938185..3938334 (-) 150 WP_128748284.1 BH0509 family protein -
  EQZ20_RS20395 (EQZ20_20395) - 3938439..3938987 (-) 549 WP_046129148.1 hypothetical protein -
  EQZ20_RS25165 - 3939139..3939297 (-) 159 WP_017475015.1 hypothetical protein -
  EQZ20_RS20400 (EQZ20_20400) - 3939311..3940144 (-) 834 WP_046129263.1 ATP-binding protein -
  EQZ20_RS20405 (EQZ20_20405) - 3940128..3940985 (-) 858 WP_046129147.1 conserved phage C-terminal domain-containing protein -
  EQZ20_RS20410 (EQZ20_20410) - 3940978..3941208 (-) 231 WP_046129146.1 hypothetical protein -
  EQZ20_RS20415 (EQZ20_20415) - 3941261..3941659 (+) 399 WP_052948490.1 hypothetical protein -
  EQZ20_RS20420 (EQZ20_20420) - 3941646..3941921 (-) 276 WP_046129145.1 hypothetical protein -
  EQZ20_RS20425 (EQZ20_20425) - 3941923..3942168 (-) 246 WP_046129144.1 hypothetical protein -
  EQZ20_RS20430 (EQZ20_20430) - 3942239..3943009 (-) 771 WP_046129143.1 phage antirepressor -
  EQZ20_RS20435 (EQZ20_20435) - 3943006..3943212 (-) 207 WP_046129142.1 helix-turn-helix transcriptional regulator -
  EQZ20_RS20440 (EQZ20_20440) - 3943249..3943440 (-) 192 WP_046129141.1 helix-turn-helix transcriptional regulator -
  EQZ20_RS20445 (EQZ20_20445) - 3943600..3944016 (+) 417 WP_052948489.1 helix-turn-helix transcriptional regulator -
  EQZ20_RS20450 (EQZ20_20450) - 3944039..3944482 (+) 444 WP_046129139.1 ImmA/IrrE family metallo-endopeptidase -
  EQZ20_RS20455 (EQZ20_20455) - 3944531..3945595 (+) 1065 WP_046129138.1 site-specific integrase -
  EQZ20_RS20465 (EQZ20_20465) smpB 3946141..3946614 (-) 474 WP_046129137.1 SsrA-binding protein -
  EQZ20_RS20470 (EQZ20_20470) rnr 3946727..3949030 (-) 2304 WP_046129136.1 ribonuclease R -
  EQZ20_RS20475 (EQZ20_20475) - 3949044..3949790 (-) 747 WP_046129135.1 carboxylesterase -
  EQZ20_RS20480 (EQZ20_20480) secG 3949908..3950138 (-) 231 WP_046129134.1 preprotein translocase subunit SecG -
  EQZ20_RS20485 (EQZ20_20485) abrB 3950298..3950582 (-) 285 WP_046129133.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EQZ20_RS20490 (EQZ20_20490) - 3950611..3950796 (-) 186 WP_096892181.1 helix-turn-helix transcriptional regulator -
  EQZ20_RS20495 (EQZ20_20495) - 3950997..3951401 (+) 405 WP_046129131.1 transcriptional regulator -
  EQZ20_RS20500 (EQZ20_20500) - 3951558..3951956 (+) 399 WP_046129130.1 helix-turn-helix transcriptional regulator -
  EQZ20_RS20505 (EQZ20_20505) - 3952003..3952680 (-) 678 WP_046129261.1 ABC transporter permease -
  EQZ20_RS20510 (EQZ20_20510) opuCC 3952701..3953582 (-) 882 WP_231947514.1 osmoprotectant ABC transporter substrate-binding protein -
  EQZ20_RS20515 (EQZ20_20515) - 3953632..3954285 (-) 654 WP_046129128.1 ABC transporter permease -
  EQZ20_RS20520 (EQZ20_20520) - 3954298..3955440 (-) 1143 WP_046129127.1 betaine/proline/choline family ABC transporter ATP-binding protein -
  EQZ20_RS20525 (EQZ20_20525) - 3955700..3956236 (+) 537 WP_046129126.1 GbsR/MarR family transcriptional regulator -
  EQZ20_RS20535 (EQZ20_20535) - 3957721..3958353 (-) 633 WP_046132922.1 NAAT family transporter -
  EQZ20_RS20540 (EQZ20_20540) - 3958502..3959281 (+) 780 WP_046132923.1 zinc ribbon domain-containing protein -
  EQZ20_RS20545 (EQZ20_20545) - 3959417..3960847 (+) 1431 WP_065894138.1 IS1182 family transposase -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10467.43 Da        Isoelectric Point: 9.8354

>NTDB_id=336553 EQZ20_RS20485 WP_046129133.1 3950298..3950582(-) (abrB) [Bacillus glycinifermentans strain SRCM103574]
MKNTGIVRRIDELGRVVLPVEMRKVLNIKEKDPLEIYSDGDSIILTKYAANMACLMTGEITTQNRAYAGGKIVLSPRGAE
LLLKDMMEALSKKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=336553 EQZ20_RS20485 WP_046129133.1 3950298..3950582(-) (abrB) [Bacillus glycinifermentans strain SRCM103574]
GTGAAAAATACCGGAATCGTAAGGAGAATCGACGAGCTTGGAAGGGTGGTCCTCCCGGTTGAAATGCGCAAGGTGCTGAA
TATCAAGGAAAAGGACCCGCTTGAAATATACAGCGACGGAGACAGCATCATTCTCACGAAGTACGCTGCCAACATGGCAT
GTCTGATGACTGGAGAAATCACAACGCAGAACAGAGCGTACGCCGGCGGCAAAATCGTGCTCAGCCCGCGCGGTGCAGAG
CTGCTTCTGAAAGATATGATGGAGGCGCTGTCGAAAAAGAAATAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)

AbrB C-terminal domain (AbrB_C)

(53-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

54.255

100

0.543

Multiple sequence alignment