Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EQY74_RS18255 Genome accession   NZ_CP035228
Coordinates   3430202..3430342 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain SRCM103529     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3425202..3435342
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQY74_RS18230 (EQY74_18230) - 3425473..3425862 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  EQY74_RS18235 (EQY74_18235) comA 3425879..3426517 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  EQY74_RS18240 (EQY74_18240) comP 3426604..3428925 (-) 2322 WP_026080865.1 ATP-binding protein Regulator
  EQY74_RS18245 (EQY74_18245) comX 3428965..3429129 (-) 165 WP_011198251.1 competence pheromone ComX -
  EQY74_RS18250 (EQY74_18250) - 3429144..3430013 (-) 870 WP_011198252.1 polyprenyl synthetase family protein -
  EQY74_RS18255 (EQY74_18255) degQ 3430202..3430342 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  EQY74_RS18265 (EQY74_18265) - 3430828..3431175 (+) 348 WP_009329512.1 hypothetical protein -
  EQY74_RS18270 (EQY74_18270) - 3431218..3432438 (-) 1221 WP_003184864.1 HDOD domain-containing protein -
  EQY74_RS18275 (EQY74_18275) - 3432617..3434086 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  EQY74_RS18280 (EQY74_18280) - 3434104..3434655 (-) 552 WP_003184868.1 isochorismatase family cysteine hydrolase -
  EQY74_RS18285 (EQY74_18285) - 3434840..3435241 (-) 402 WP_003184870.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=336318 EQY74_RS18255 WP_003184860.1 3430202..3430342(-) (degQ) [Bacillus licheniformis strain SRCM103529]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=336318 EQY74_RS18255 WP_003184860.1 3430202..3430342(-) (degQ) [Bacillus licheniformis strain SRCM103529]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment