Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   EQJ84_RS12790 Genome accession   NZ_CP035191
Coordinates   2490234..2490644 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain SRCM104011     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2485599..2537092 2490234..2490644 within 0


Gene organization within MGE regions


Location: 2485599..2537092
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ84_RS12765 (EQJ84_12765) yqeF 2485766..2486497 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  EQJ84_RS12770 (EQJ84_12770) cwlH 2486749..2487501 (-) 753 WP_021480067.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  EQJ84_RS12775 (EQJ84_12775) yqeD 2487688..2488314 (+) 627 WP_041850032.1 TVP38/TMEM64 family protein -
  EQJ84_RS12780 (EQJ84_12780) gnd 2488334..2489227 (-) 894 WP_041850033.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  EQJ84_RS12785 (EQJ84_12785) yqeB 2489479..2490201 (+) 723 WP_032726205.1 hypothetical protein -
  EQJ84_RS12790 (EQJ84_12790) nucA/comI 2490234..2490644 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  EQJ84_RS12795 (EQJ84_12795) - 2490840..2491187 (+) 348 Protein_2466 sigma-70 family RNA polymerase sigma factor -
  EQJ84_RS12800 (EQJ84_12800) spoIVCA 2491218..2492678 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  EQJ84_RS21485 (EQJ84_12805) - 2492636..2492814 (-) 179 Protein_2468 hypothetical protein -
  EQJ84_RS12810 (EQJ84_12810) arsC 2493169..2493588 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  EQJ84_RS12815 (EQJ84_12815) acr3 2493600..2494640 (-) 1041 WP_032722149.1 arsenite efflux transporter Acr3 -
  EQJ84_RS12820 (EQJ84_12820) arsK 2494663..2495103 (-) 441 WP_128441741.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  EQJ84_RS12825 (EQJ84_12825) arsR 2495162..2495479 (-) 318 WP_029318103.1 arsenical resistance operon transcriptional regulator ArsR -
  EQJ84_RS12830 (EQJ84_12830) yqcI 2495851..2496615 (-) 765 WP_017696291.1 YqcI/YcgG family protein -
  EQJ84_RS12835 (EQJ84_12835) rapE 2497058..2498185 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  EQJ84_RS12840 (EQJ84_12840) phrE 2498175..2498309 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  EQJ84_RS12845 (EQJ84_12845) - 2498419..2498577 (+) 159 WP_003245945.1 hypothetical protein -
  EQJ84_RS12850 (EQJ84_12850) yqcG 2498947..2500542 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  EQJ84_RS12855 (EQJ84_12855) yqcF 2500557..2501135 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  EQJ84_RS12860 (EQJ84_12860) - 2501253..2501399 (+) 147 WP_009967791.1 hypothetical protein -
  EQJ84_RS12865 (EQJ84_12865) - 2501396..2501758 (-) 363 WP_003229947.1 hypothetical protein -
  EQJ84_RS12870 (EQJ84_12870) - 2501774..2502253 (-) 480 WP_004399085.1 hypothetical protein -
  EQJ84_RS12875 (EQJ84_12875) cwlA 2502418..2503236 (-) 819 WP_017697459.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  EQJ84_RS12880 (EQJ84_12880) skhD 2503281..2503703 (-) 423 WP_017697460.1 holin family protein -
  EQJ84_RS12885 (EQJ84_12885) xepAK 2503749..2504642 (-) 894 WP_032722160.1 hypothetical protein -
  EQJ84_RS12890 (EQJ84_12890) yqcE 2504730..2504894 (-) 165 WP_003229944.1 XkdX family protein -
  EQJ84_RS12895 (EQJ84_12895) yqcD 2504891..2505226 (-) 336 WP_009967793.1 XkdW family protein -
  EQJ84_RS12900 (EQJ84_12900) yqcC 2505236..2506336 (-) 1101 WP_032722161.1 pyocin knob domain-containing protein -
  EQJ84_RS12905 (EQJ84_12905) - 2506340..2506612 (-) 273 WP_032722163.1 hypothetical protein -
  EQJ84_RS12910 (EQJ84_12910) yqcA 2506609..2507187 (-) 579 WP_032722164.1 YmfQ family protein -
  EQJ84_RS12915 (EQJ84_12915) yqbT 2507171..2508217 (-) 1047 WP_032722165.1 baseplate J/gp47 family protein -
  EQJ84_RS12920 (EQJ84_12920) yqbS 2508210..2508635 (-) 426 WP_032722166.1 DUF2634 domain-containing protein -
  EQJ84_RS12925 (EQJ84_12925) yqbR 2508648..2508914 (-) 267 WP_032722167.1 DUF2577 family protein -
  EQJ84_RS12930 (EQJ84_12930) yqbQ 2508911..2509891 (-) 981 WP_032722168.1 hypothetical protein -
  EQJ84_RS12935 (EQJ84_12935) yqbP 2509904..2510563 (-) 660 WP_032722169.1 LysM peptidoglycan-binding domain-containing protein -
  EQJ84_RS12940 (EQJ84_12940) yqbO 2510556..2515313 (-) 4758 WP_043940167.1 phage tail tape measure protein -
  EQJ84_RS12945 (EQJ84_12945) - 2515316..2515453 (-) 138 WP_021480099.1 hypothetical protein -
  EQJ84_RS12950 (EQJ84_12950) - 2515495..2515944 (-) 450 WP_032722171.1 phage portal protein -
  EQJ84_RS12955 (EQJ84_12955) txpA 2516090..2516269 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  EQJ84_RS12960 (EQJ84_12960) bsrH 2516649..2516738 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  EQJ84_RS12965 (EQJ84_12965) yqbM 2516992..2517435 (-) 444 WP_003229930.1 phage tail tube protein -
  EQJ84_RS12970 (EQJ84_12970) yqbK 2517438..2518838 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  EQJ84_RS12975 (EQJ84_12975) - 2518839..2518988 (-) 150 WP_128484481.1 hypothetical protein -
  EQJ84_RS12980 (EQJ84_12980) yqbJ 2519026..2519463 (-) 438 WP_003229927.1 DUF6838 family protein -
  EQJ84_RS12985 (EQJ84_12985) yqbI 2519476..2519979 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  EQJ84_RS12990 (EQJ84_12990) yqbH 2519976..2520338 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  EQJ84_RS12995 (EQJ84_12995) gkpG 2520335..2520730 (-) 396 WP_004398566.1 DUF3199 family protein -
  EQJ84_RS13000 (EQJ84_13000) yqbF 2520734..2521045 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  EQJ84_RS13005 (EQJ84_13005) skdG 2521056..2521991 (-) 936 WP_128441743.1 phage major capsid protein -
  EQJ84_RS13010 (EQJ84_13010) yqbD 2522010..2522978 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  EQJ84_RS13015 (EQJ84_13015) - 2523011..2523664 (-) 654 WP_003229920.1 hypothetical protein -
  EQJ84_RS13020 (EQJ84_13020) yqbB 2523705..2524622 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  EQJ84_RS13025 (EQJ84_13025) yqbA 2524619..2526151 (-) 1533 WP_004398894.1 phage portal protein -
  EQJ84_RS13030 (EQJ84_13030) stmB 2526155..2527450 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  EQJ84_RS13035 (EQJ84_13035) terS 2527443..2528162 (-) 720 WP_003229916.1 phage terminase small subunit -
  EQJ84_RS13040 (EQJ84_13040) - 2528230..2528694 (-) 465 WP_004398685.1 hypothetical protein -
  EQJ84_RS13045 (EQJ84_13045) yqaQ 2528838..2529293 (-) 456 WP_004398775.1 hypothetical protein -
  EQJ84_RS13050 (EQJ84_13050) - 2529491..2530420 (+) 930 WP_003229913.1 hypothetical protein -
  EQJ84_RS13055 (EQJ84_13055) yqaO 2530494..2530700 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  EQJ84_RS13060 (EQJ84_13060) yqaN 2530782..2531210 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  EQJ84_RS13065 (EQJ84_13065) - 2531306..2531455 (-) 150 WP_003229910.1 hypothetical protein -
  EQJ84_RS13070 (EQJ84_13070) sknM 2531446..2532387 (-) 942 WP_075058863.1 ATP-binding protein -
  EQJ84_RS13075 (EQJ84_13075) yqaL 2532269..2532946 (-) 678 WP_116362964.1 DnaD domain protein -
  EQJ84_RS13080 (EQJ84_13080) recT 2533022..2533876 (-) 855 WP_003229907.1 recombinase RecT -
  EQJ84_RS13085 (EQJ84_13085) yqaJ 2533879..2534838 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  EQJ84_RS13090 (EQJ84_13090) - 2534944..2535138 (-) 195 WP_003229905.1 hypothetical protein -
  EQJ84_RS13095 (EQJ84_13095) - 2535098..2535271 (-) 174 WP_119123069.1 hypothetical protein -
  EQJ84_RS13100 (EQJ84_13100) sknH 2535268..2535525 (-) 258 WP_003245994.1 YqaH family protein -
  EQJ84_RS13105 (EQJ84_13105) yqaG 2535522..2536091 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  EQJ84_RS13110 (EQJ84_13110) - 2536165..2536305 (-) 141 WP_003229902.1 hypothetical protein -
  EQJ84_RS13115 (EQJ84_13115) yqaF 2536335..2536565 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  EQJ84_RS13120 (EQJ84_13120) sknR 2536742..2537092 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=335911 EQJ84_RS12790 WP_009967785.1 2490234..2490644(-) (nucA/comI) [Bacillus subtilis strain SRCM104011]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=335911 EQJ84_RS12790 WP_009967785.1 2490234..2490644(-) (nucA/comI) [Bacillus subtilis strain SRCM104011]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCAATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment