Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EQJ69_RS18395 Genome accession   NZ_CP035188
Coordinates   3500825..3501109 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain SRCM103914     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3454605..3505982 3500825..3501109 within 0


Gene organization within MGE regions


Location: 3454605..3505982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ69_RS18095 (EQJ69_18095) - 3454605..3455195 (+) 591 WP_003185308.1 hypothetical protein -
  EQJ69_RS18100 (EQJ69_18100) - 3455297..3455671 (+) 375 Protein_3520 YolD-like family protein -
  EQJ69_RS18105 (EQJ69_18105) - 3456079..3456789 (-) 711 WP_003185310.1 DUF421 domain-containing protein -
  EQJ69_RS18110 (EQJ69_18110) - 3456997..3457848 (+) 852 WP_035334177.1 ferritin family protein -
  EQJ69_RS18115 (EQJ69_18115) - 3458004..3458597 (+) 594 WP_003185315.1 cupin domain-containing protein -
  EQJ69_RS18120 (EQJ69_18120) - 3458718..3459671 (-) 954 WP_003185317.1 glycoside hydrolase family 25 protein -
  EQJ69_RS18125 (EQJ69_18125) - 3459719..3459982 (-) 264 WP_003185319.1 phage holin -
  EQJ69_RS18130 (EQJ69_18130) - 3459998..3460267 (-) 270 WP_003185322.1 hemolysin XhlA family protein -
  EQJ69_RS18135 (EQJ69_18135) - 3460330..3460515 (-) 186 WP_003185324.1 XkdX family protein -
  EQJ69_RS18140 (EQJ69_18140) - 3460512..3460835 (-) 324 WP_003185326.1 bZIP transcription factor -
  EQJ69_RS18145 (EQJ69_18145) - 3460848..3462185 (-) 1338 WP_003185328.1 BppU family phage baseplate upper protein -
  EQJ69_RS23805 - 3462206..3464251 (-) 2046 WP_035334112.1 hypothetical protein -
  EQJ69_RS18155 (EQJ69_18155) - 3464288..3466000 (-) 1713 WP_003185331.1 phage tail protein -
  EQJ69_RS18160 (EQJ69_18160) - 3466013..3466849 (-) 837 WP_003185333.1 phage tail family protein -
  EQJ69_RS18165 (EQJ69_18165) - 3466849..3471321 (-) 4473 WP_075178266.1 phage tail tape measure protein -
  EQJ69_RS18170 (EQJ69_18170) - 3471529..3471891 (-) 363 WP_073358627.1 hypothetical protein -
  EQJ69_RS18175 (EQJ69_18175) - 3471945..3472562 (-) 618 WP_003185341.1 major tail protein -
  EQJ69_RS18180 (EQJ69_18180) - 3472577..3472960 (-) 384 WP_003185344.1 hypothetical protein -
  EQJ69_RS18185 (EQJ69_18185) - 3472957..3473355 (-) 399 WP_003185346.1 HK97-gp10 family putative phage morphogenesis protein -
  EQJ69_RS18190 (EQJ69_18190) - 3473355..3473663 (-) 309 WP_003185349.1 phage head closure protein -
  EQJ69_RS18195 (EQJ69_18195) - 3473653..3473955 (-) 303 WP_003185351.1 head-tail connector protein -
  EQJ69_RS18200 (EQJ69_18200) - 3473976..3474401 (-) 426 WP_003185353.1 collagen-like protein -
  EQJ69_RS18205 (EQJ69_18205) - 3474425..3475708 (-) 1284 Protein_3541 phage major capsid protein -
  EQJ69_RS18210 (EQJ69_18210) - 3475747..3476478 (-) 732 WP_021837714.1 head maturation protease, ClpP-related -
  EQJ69_RS18215 (EQJ69_18215) - 3476423..3477733 (-) 1311 WP_003185359.1 phage portal protein -
  EQJ69_RS18220 (EQJ69_18220) - 3477734..3477925 (-) 192 WP_073358629.1 DUF1056 family protein -
  EQJ69_RS18225 (EQJ69_18225) - 3477937..3479646 (-) 1710 WP_025807610.1 terminase TerL endonuclease subunit -
  EQJ69_RS18230 (EQJ69_18230) - 3479643..3480158 (-) 516 WP_026080867.1 phage terminase small subunit P27 family -
  EQJ69_RS18240 (EQJ69_18240) - 3480388..3480762 (-) 375 WP_021837717.1 HNH endonuclease -
  EQJ69_RS18245 (EQJ69_18245) - 3480789..3481097 (-) 309 WP_073358674.1 hypothetical protein -
  EQJ69_RS18250 (EQJ69_18250) cotD 3481318..3481542 (-) 225 WP_006637235.1 spore coat protein CotD -
  EQJ69_RS18255 (EQJ69_18255) - 3482293..3482673 (-) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  EQJ69_RS18260 (EQJ69_18260) - 3482786..3483163 (-) 378 WP_025807623.1 YopX family protein -
  EQJ69_RS18265 (EQJ69_18265) - 3483179..3483700 (-) 522 WP_234013691.1 putative metallopeptidase -
  EQJ69_RS18270 (EQJ69_18270) - 3483697..3483867 (-) 171 WP_071583658.1 Fur-regulated basic protein FbpA -
  EQJ69_RS18275 (EQJ69_18275) - 3483864..3484403 (-) 540 WP_073358634.1 ERCC4 domain-containing protein -
  EQJ69_RS18280 (EQJ69_18280) - 3484400..3484837 (-) 438 WP_073358636.1 hypothetical protein -
  EQJ69_RS18285 (EQJ69_18285) - 3484815..3485078 (-) 264 WP_016886542.1 hypothetical protein -
  EQJ69_RS18290 (EQJ69_18290) - 3485354..3487786 (-) 2433 WP_016886541.1 phage/plasmid primase, P4 family -
  EQJ69_RS18295 (EQJ69_18295) - 3487847..3488284 (-) 438 WP_003185383.1 DUF669 domain-containing protein -
  EQJ69_RS18300 (EQJ69_18300) - 3488284..3489216 (-) 933 WP_011198320.1 AAA family ATPase -
  EQJ69_RS18305 (EQJ69_18305) - 3489220..3489780 (-) 561 WP_016886540.1 host-nuclease inhibitor Gam family protein -
  EQJ69_RS18310 (EQJ69_18310) - 3489872..3490114 (-) 243 WP_011198322.1 hypothetical protein -
  EQJ69_RS18315 (EQJ69_18315) - 3490202..3490468 (-) 267 WP_009330095.1 YqaH family protein -
  EQJ69_RS18320 (EQJ69_18320) - 3490531..3491082 (+) 552 WP_016886538.1 hypothetical protein -
  EQJ69_RS23445 - 3491054..3491209 (-) 156 WP_155266364.1 hypothetical protein -
  EQJ69_RS18325 (EQJ69_18325) - 3491335..3491889 (-) 555 WP_003185401.1 hypothetical protein -
  EQJ69_RS18330 (EQJ69_18330) - 3491947..3492135 (-) 189 WP_016886536.1 hypothetical protein -
  EQJ69_RS18335 (EQJ69_18335) - 3492267..3492455 (-) 189 WP_003185403.1 helix-turn-helix domain-containing protein -
  EQJ69_RS18340 (EQJ69_18340) - 3492452..3493246 (-) 795 WP_016886535.1 ORF6N domain-containing protein -
  EQJ69_RS18345 (EQJ69_18345) - 3493308..3493625 (+) 318 WP_016886534.1 hypothetical protein -
  EQJ69_RS18350 (EQJ69_18350) - 3493588..3493857 (-) 270 WP_016886533.1 hypothetical protein -
  EQJ69_RS18355 (EQJ69_18355) - 3493872..3494111 (-) 240 WP_016886532.1 helix-turn-helix transcriptional regulator -
  EQJ69_RS18360 (EQJ69_18360) - 3494268..3494918 (+) 651 WP_016886531.1 LexA family transcriptional regulator -
  EQJ69_RS18365 (EQJ69_18365) - 3494989..3496083 (+) 1095 WP_003185410.1 site-specific integrase -
  EQJ69_RS18375 (EQJ69_18375) smpB 3496635..3497108 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  EQJ69_RS18380 (EQJ69_18380) rnr 3497220..3499523 (-) 2304 WP_003185414.1 ribonuclease R -
  EQJ69_RS18385 (EQJ69_18385) - 3499537..3500283 (-) 747 WP_011198329.1 carboxylesterase -
  EQJ69_RS18390 (EQJ69_18390) secG 3500424..3500654 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  EQJ69_RS18395 (EQJ69_18395) abrB 3500825..3501109 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EQJ69_RS18400 (EQJ69_18400) - 3501138..3501371 (-) 234 WP_085959538.1 helix-turn-helix transcriptional regulator -
  EQJ69_RS18405 (EQJ69_18405) - 3501524..3501925 (+) 402 WP_009329609.1 transcriptional regulator -
  EQJ69_RS18410 (EQJ69_18410) - 3502097..3502495 (+) 399 WP_009329610.1 helix-turn-helix transcriptional regulator -
  EQJ69_RS18415 (EQJ69_18415) - 3502543..3503220 (-) 678 WP_003185432.1 ABC transporter permease -
  EQJ69_RS18420 (EQJ69_18420) opuCC 3503237..3504154 (-) 918 WP_009329611.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  EQJ69_RS18425 (EQJ69_18425) - 3504168..3504821 (-) 654 WP_009329612.1 ABC transporter permease -
  EQJ69_RS18430 (EQJ69_18430) - 3504843..3505982 (-) 1140 WP_003185439.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=335846 EQJ69_RS18395 WP_003185421.1 3500825..3501109(-) (abrB) [Bacillus licheniformis strain SRCM103914]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=335846 EQJ69_RS18395 WP_003185421.1 3500825..3501109(-) (abrB) [Bacillus licheniformis strain SRCM103914]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543

Multiple sequence alignment