Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   EQJ08_RS12790 Genome accession   NZ_CP035167
Coordinates   2490235..2490645 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain SRCM104008     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2485600..2537094 2490235..2490645 within 0


Gene organization within MGE regions


Location: 2485600..2537094
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQJ08_RS12765 (EQJ08_12765) yqeF 2485767..2486498 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  EQJ08_RS12770 (EQJ08_12770) cwlH 2486750..2487502 (-) 753 WP_021480067.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  EQJ08_RS12775 (EQJ08_12775) yqeD 2487689..2488315 (+) 627 WP_041850032.1 TVP38/TMEM64 family protein -
  EQJ08_RS12780 (EQJ08_12780) gnd 2488335..2489228 (-) 894 WP_041850033.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  EQJ08_RS12785 (EQJ08_12785) yqeB 2489480..2490202 (+) 723 WP_032726205.1 hypothetical protein -
  EQJ08_RS12790 (EQJ08_12790) nucA/comI 2490235..2490645 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  EQJ08_RS12795 (EQJ08_12795) - 2490841..2491188 (+) 348 Protein_2470 sigma-70 family RNA polymerase sigma factor -
  EQJ08_RS12800 (EQJ08_12800) spoIVCA 2491219..2492679 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  EQJ08_RS21205 (EQJ08_12805) - 2492637..2492815 (-) 179 Protein_2472 hypothetical protein -
  EQJ08_RS12810 (EQJ08_12810) arsC 2493170..2493589 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  EQJ08_RS12815 (EQJ08_12815) acr3 2493601..2494641 (-) 1041 WP_032722149.1 arsenite efflux transporter Acr3 -
  EQJ08_RS12820 (EQJ08_12820) arsK 2494664..2495104 (-) 441 WP_128441741.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  EQJ08_RS12825 (EQJ08_12825) arsR 2495163..2495480 (-) 318 WP_029318103.1 arsenical resistance operon transcriptional regulator ArsR -
  EQJ08_RS12830 (EQJ08_12830) yqcI 2495852..2496616 (-) 765 WP_017696291.1 YqcI/YcgG family protein -
  EQJ08_RS12835 (EQJ08_12835) rapE 2497059..2498186 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  EQJ08_RS12840 (EQJ08_12840) phrE 2498176..2498310 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  EQJ08_RS12845 (EQJ08_12845) - 2498420..2498578 (+) 159 WP_003245945.1 hypothetical protein -
  EQJ08_RS12850 (EQJ08_12850) yqcG 2498948..2500543 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  EQJ08_RS12855 (EQJ08_12855) yqcF 2500558..2501136 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  EQJ08_RS12860 (EQJ08_12860) - 2501254..2501400 (+) 147 WP_009967791.1 hypothetical protein -
  EQJ08_RS12865 (EQJ08_12865) - 2501397..2501759 (-) 363 WP_003229947.1 hypothetical protein -
  EQJ08_RS12870 (EQJ08_12870) - 2501775..2502254 (-) 480 WP_004399085.1 hypothetical protein -
  EQJ08_RS12875 (EQJ08_12875) cwlA 2502419..2503237 (-) 819 WP_017697459.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  EQJ08_RS12880 (EQJ08_12880) skhD 2503282..2503704 (-) 423 WP_017697460.1 holin family protein -
  EQJ08_RS12885 (EQJ08_12885) xepAK 2503750..2504643 (-) 894 WP_032722160.1 hypothetical protein -
  EQJ08_RS12890 (EQJ08_12890) yqcE 2504731..2504895 (-) 165 WP_003229944.1 XkdX family protein -
  EQJ08_RS12895 (EQJ08_12895) yqcD 2504892..2505227 (-) 336 WP_009967793.1 XkdW family protein -
  EQJ08_RS12900 (EQJ08_12900) yqcC 2505237..2506337 (-) 1101 WP_032722161.1 pyocin knob domain-containing protein -
  EQJ08_RS12905 (EQJ08_12905) - 2506341..2506613 (-) 273 WP_032722163.1 hypothetical protein -
  EQJ08_RS12910 (EQJ08_12910) yqcA 2506610..2507188 (-) 579 WP_032722164.1 YmfQ family protein -
  EQJ08_RS12915 (EQJ08_12915) yqbT 2507172..2508218 (-) 1047 WP_032722165.1 baseplate J/gp47 family protein -
  EQJ08_RS12920 (EQJ08_12920) yqbS 2508211..2508636 (-) 426 WP_032722166.1 DUF2634 domain-containing protein -
  EQJ08_RS12925 (EQJ08_12925) yqbR 2508649..2508915 (-) 267 WP_032722167.1 DUF2577 family protein -
  EQJ08_RS12930 (EQJ08_12930) yqbQ 2508912..2509892 (-) 981 WP_032722168.1 hypothetical protein -
  EQJ08_RS12935 (EQJ08_12935) yqbP 2509905..2510564 (-) 660 WP_032722169.1 LysM peptidoglycan-binding domain-containing protein -
  EQJ08_RS12940 (EQJ08_12940) yqbO 2510557..2515314 (-) 4758 WP_043940167.1 phage tail tape measure protein -
  EQJ08_RS12945 (EQJ08_12945) - 2515317..2515454 (-) 138 WP_021480099.1 hypothetical protein -
  EQJ08_RS12950 (EQJ08_12950) - 2515496..2515945 (-) 450 WP_032722171.1 phage portal protein -
  EQJ08_RS12955 (EQJ08_12955) txpA 2516091..2516270 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  EQJ08_RS12960 (EQJ08_12960) bsrH 2516650..2516739 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  EQJ08_RS12965 (EQJ08_12965) yqbM 2516993..2517436 (-) 444 WP_003229930.1 phage tail tube protein -
  EQJ08_RS12970 (EQJ08_12970) yqbK 2517439..2518839 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  EQJ08_RS12975 (EQJ08_12975) - 2518840..2519031 (-) 192 WP_010886574.1 hypothetical protein -
  EQJ08_RS12980 (EQJ08_12980) yqbJ 2519028..2519465 (-) 438 WP_003229927.1 DUF6838 family protein -
  EQJ08_RS12985 (EQJ08_12985) yqbI 2519478..2519981 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  EQJ08_RS12990 (EQJ08_12990) yqbH 2519978..2520340 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  EQJ08_RS12995 (EQJ08_12995) gkpG 2520337..2520732 (-) 396 WP_004398566.1 DUF3199 family protein -
  EQJ08_RS13000 (EQJ08_13000) yqbF 2520736..2521047 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  EQJ08_RS13005 (EQJ08_13005) skdG 2521058..2521993 (-) 936 WP_128441743.1 phage major capsid protein -
  EQJ08_RS13010 (EQJ08_13010) yqbD 2522012..2522980 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  EQJ08_RS13015 (EQJ08_13015) - 2523013..2523666 (-) 654 WP_003229920.1 hypothetical protein -
  EQJ08_RS13020 (EQJ08_13020) yqbB 2523707..2524624 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  EQJ08_RS13025 (EQJ08_13025) yqbA 2524621..2526153 (-) 1533 WP_004398894.1 phage portal protein -
  EQJ08_RS13030 (EQJ08_13030) stmB 2526157..2527452 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  EQJ08_RS13035 (EQJ08_13035) terS 2527445..2528164 (-) 720 WP_003229916.1 phage terminase small subunit -
  EQJ08_RS13040 (EQJ08_13040) - 2528232..2528696 (-) 465 WP_004398685.1 hypothetical protein -
  EQJ08_RS13045 (EQJ08_13045) yqaQ 2528840..2529295 (-) 456 WP_004398775.1 hypothetical protein -
  EQJ08_RS13050 (EQJ08_13050) - 2529493..2530422 (+) 930 WP_003229913.1 hypothetical protein -
  EQJ08_RS13055 (EQJ08_13055) yqaO 2530496..2530702 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  EQJ08_RS13060 (EQJ08_13060) yqaN 2530784..2531212 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  EQJ08_RS13065 (EQJ08_13065) - 2531308..2531457 (-) 150 WP_003229910.1 hypothetical protein -
  EQJ08_RS13070 (EQJ08_13070) sknM 2531448..2532389 (-) 942 WP_075058863.1 ATP-binding protein -
  EQJ08_RS13075 (EQJ08_13075) yqaL 2532271..2532948 (-) 678 WP_116362964.1 DnaD domain protein -
  EQJ08_RS13080 (EQJ08_13080) recT 2533024..2533878 (-) 855 WP_003229907.1 recombinase RecT -
  EQJ08_RS13085 (EQJ08_13085) yqaJ 2533881..2534840 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  EQJ08_RS13090 (EQJ08_13090) - 2534946..2535140 (-) 195 WP_003229905.1 hypothetical protein -
  EQJ08_RS13095 (EQJ08_13095) - 2535100..2535273 (-) 174 WP_119123069.1 hypothetical protein -
  EQJ08_RS13100 (EQJ08_13100) sknH 2535270..2535527 (-) 258 WP_003245994.1 YqaH family protein -
  EQJ08_RS13105 (EQJ08_13105) yqaG 2535524..2536093 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  EQJ08_RS13110 (EQJ08_13110) - 2536167..2536307 (-) 141 WP_003229902.1 hypothetical protein -
  EQJ08_RS13115 (EQJ08_13115) yqaF 2536337..2536567 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  EQJ08_RS13120 (EQJ08_13120) sknR 2536744..2537094 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=335453 EQJ08_RS12790 WP_009967785.1 2490235..2490645(-) (nucA/comI) [Bacillus subtilis strain SRCM104008]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=335453 EQJ08_RS12790 WP_009967785.1 2490235..2490645(-) (nucA/comI) [Bacillus subtilis strain SRCM104008]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCAATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment