Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EQI87_RS16630 Genome accession   NZ_CP035166
Coordinates   3155170..3155310 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103971     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3150170..3160310
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI87_RS16605 (EQI87_16605) yuxO 3150447..3150827 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  EQI87_RS16610 (EQI87_16610) comA 3150846..3151490 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQI87_RS16615 (EQI87_16615) comP 3151571..3153883 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  EQI87_RS16620 (EQI87_16620) comX 3153899..3154120 (-) 222 WP_014480704.1 competence pheromone ComX -
  EQI87_RS16625 (EQI87_16625) - 3154122..3154985 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  EQI87_RS16630 (EQI87_16630) degQ 3155170..3155310 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQI87_RS16635 (EQI87_16635) - 3155532..3155657 (+) 126 WP_003228793.1 hypothetical protein -
  EQI87_RS16640 (EQI87_16640) - 3155772..3156140 (+) 369 WP_046381300.1 hypothetical protein -
  EQI87_RS16645 (EQI87_16645) pdeH 3156116..3157345 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  EQI87_RS16650 (EQI87_16650) pncB 3157482..3158954 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQI87_RS16655 (EQI87_16655) pncA 3158970..3159521 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  EQI87_RS16660 (EQI87_16660) yueI 3159618..3160016 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=335385 EQI87_RS16630 WP_003220708.1 3155170..3155310(-) (degQ) [Bacillus subtilis strain SRCM103971]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=335385 EQI87_RS16630 WP_003220708.1 3155170..3155310(-) (degQ) [Bacillus subtilis strain SRCM103971]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment