Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EQI48_RS16725 Genome accession   NZ_CP035164
Coordinates   3175480..3175620 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM104005     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3170480..3180620
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI48_RS16700 (EQI48_16700) yuxO 3170793..3171173 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  EQI48_RS16705 (EQI48_16705) comA 3171192..3171836 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQI48_RS16710 (EQI48_16710) comP 3171917..3174226 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  EQI48_RS16715 (EQI48_16715) comX 3174241..3174408 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  EQI48_RS16720 (EQI48_16720) comQ 3174396..3175295 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  EQI48_RS16725 (EQI48_16725) degQ 3175480..3175620 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQI48_RS16730 (EQI48_16730) - 3175842..3175967 (+) 126 WP_003228793.1 hypothetical protein -
  EQI48_RS16735 (EQI48_16735) - 3176081..3176449 (+) 369 WP_014477834.1 hypothetical protein -
  EQI48_RS16740 (EQI48_16740) pdeH 3176425..3177654 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  EQI48_RS16745 (EQI48_16745) pncB 3177791..3179263 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQI48_RS16750 (EQI48_16750) pncA 3179279..3179830 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  EQI48_RS16755 (EQI48_16755) yueI 3179927..3180325 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=335222 EQI48_RS16725 WP_003220708.1 3175480..3175620(-) (degQ) [Bacillus subtilis strain SRCM104005]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=335222 EQI48_RS16725 WP_003220708.1 3175480..3175620(-) (degQ) [Bacillus subtilis strain SRCM104005]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment