Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EQI27_RS16425 Genome accession   NZ_CP035163
Coordinates   3137276..3137416 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103923     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3132276..3142416
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI27_RS16400 (EQI27_16400) yuxO 3132619..3132999 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  EQI27_RS16405 (EQI27_16405) comA 3133018..3133662 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQI27_RS16410 (EQI27_16410) comP 3133743..3136043 (-) 2301 WP_088300729.1 histidine kinase Regulator
  EQI27_RS16415 (EQI27_16415) comX 3136055..3136219 (-) 165 WP_015384519.1 competence pheromone ComX -
  EQI27_RS16420 (EQI27_16420) - 3136232..3137092 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  EQI27_RS16425 (EQI27_16425) degQ 3137276..3137416 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQI27_RS21640 - 3137638..3137700 (+) 63 Protein_3172 hypothetical protein -
  EQI27_RS16430 (EQI27_16430) - 3137879..3138247 (+) 369 WP_041850584.1 hypothetical protein -
  EQI27_RS16435 (EQI27_16435) pdeH 3138223..3139452 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  EQI27_RS16440 (EQI27_16440) pncB 3139589..3141061 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQI27_RS16445 (EQI27_16445) pncA 3141077..3141628 (-) 552 WP_043940186.1 isochorismatase family cysteine hydrolase -
  EQI27_RS16450 (EQI27_16450) yueI 3141725..3142123 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=335142 EQI27_RS16425 WP_003220708.1 3137276..3137416(-) (degQ) [Bacillus subtilis strain SRCM103923]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=335142 EQI27_RS16425 WP_003220708.1 3137276..3137416(-) (degQ) [Bacillus subtilis strain SRCM103923]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment