Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   EQI27_RS13075 Genome accession   NZ_CP035163
Coordinates   2524753..2525163 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain SRCM103923     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2525359..2575481 2524753..2525163 flank 196


Gene organization within MGE regions


Location: 2524753..2575481
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI27_RS13075 (EQI27_13075) nucA/comI 2524753..2525163 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  EQI27_RS13080 (EQI27_13080) - 2525359..2525709 (+) 351 Protein_2535 sigma-70 family RNA polymerase sigma factor -
  EQI27_RS13085 (EQI27_13085) spoIVCA 2525736..2527196 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  EQI27_RS21605 (EQI27_13090) - 2527154..2527332 (-) 179 Protein_2537 hypothetical protein -
  EQI27_RS13095 (EQI27_13095) arsC 2527687..2528106 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  EQI27_RS13100 (EQI27_13100) acr3 2528118..2529158 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  EQI27_RS13105 (EQI27_13105) arsK 2529181..2529621 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  EQI27_RS13110 (EQI27_13110) arsR 2529681..2529998 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  EQI27_RS13115 (EQI27_13115) yqcI 2530370..2531134 (-) 765 WP_085186524.1 YqcI/YcgG family protein -
  EQI27_RS13120 (EQI27_13120) rapE 2531577..2532704 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  EQI27_RS13125 (EQI27_13125) phrE 2532694..2532828 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  EQI27_RS13130 (EQI27_13130) - 2532938..2533096 (+) 159 WP_003245945.1 hypothetical protein -
  EQI27_RS13135 (EQI27_13135) yqcG 2533466..2535060 (+) 1595 Protein_2546 LXG family T7SS effector endonuclease toxin YqcG -
  EQI27_RS13140 (EQI27_13140) - 2535219..2535652 (+) 434 Protein_2547 suppressor of fused domain protein -
  EQI27_RS13145 (EQI27_13145) - 2535770..2535916 (+) 147 WP_009967791.1 hypothetical protein -
  EQI27_RS13150 (EQI27_13150) - 2535913..2536275 (-) 363 WP_003229947.1 hypothetical protein -
  EQI27_RS13155 (EQI27_13155) - 2536291..2536770 (-) 480 WP_004399085.1 hypothetical protein -
  EQI27_RS13160 (EQI27_13160) cwlA 2536935..2537753 (-) 819 WP_017697459.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  EQI27_RS13165 (EQI27_13165) skhD 2537798..2538220 (-) 423 WP_017697460.1 holin family protein -
  EQI27_RS13170 (EQI27_13170) xepAK 2538266..2539159 (-) 894 WP_032722160.1 hypothetical protein -
  EQI27_RS13175 (EQI27_13175) yqcE 2539247..2539411 (-) 165 WP_003229944.1 XkdX family protein -
  EQI27_RS13180 (EQI27_13180) yqcD 2539408..2539743 (-) 336 WP_009967793.1 XkdW family protein -
  EQI27_RS13185 (EQI27_13185) yqcC 2539753..2540853 (-) 1101 WP_032722161.1 pyocin knob domain-containing protein -
  EQI27_RS13190 (EQI27_13190) - 2540857..2541129 (-) 273 WP_032722163.1 hypothetical protein -
  EQI27_RS13195 (EQI27_13195) yqcA 2541126..2541704 (-) 579 WP_032722164.1 YmfQ family protein -
  EQI27_RS13200 (EQI27_13200) yqbT 2541688..2542734 (-) 1047 WP_032722165.1 baseplate J/gp47 family protein -
  EQI27_RS13205 (EQI27_13205) yqbS 2542727..2543152 (-) 426 WP_032722166.1 DUF2634 domain-containing protein -
  EQI27_RS13210 (EQI27_13210) yqbR 2543165..2543431 (-) 267 WP_032722167.1 DUF2577 family protein -
  EQI27_RS13215 (EQI27_13215) yqbQ 2543428..2544408 (-) 981 WP_032722168.1 hypothetical protein -
  EQI27_RS13220 (EQI27_13220) yqbP 2544421..2545080 (-) 660 WP_032722169.1 LysM peptidoglycan-binding domain-containing protein -
  EQI27_RS13225 (EQI27_13225) yqbO 2545073..2549830 (-) 4758 WP_043940167.1 phage tail tape measure protein -
  EQI27_RS13230 (EQI27_13230) - 2549833..2549970 (-) 138 WP_021480099.1 hypothetical protein -
  EQI27_RS13235 (EQI27_13235) - 2550012..2550461 (-) 450 WP_032722171.1 phage portal protein -
  EQI27_RS13240 (EQI27_13240) txpA 2550607..2550786 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  EQI27_RS13245 (EQI27_13245) bsrH 2551166..2551255 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  EQI27_RS13250 (EQI27_13250) yqbM 2551509..2551952 (-) 444 WP_003229930.1 phage tail tube protein -
  EQI27_RS13255 (EQI27_13255) yqbK 2551955..2553354 (-) 1400 Protein_2570 phage tail sheath family protein -
  EQI27_RS13260 (EQI27_13260) - 2553355..2553546 (-) 192 WP_010886574.1 hypothetical protein -
  EQI27_RS13265 (EQI27_13265) yqbJ 2553543..2553980 (-) 438 WP_003229927.1 DUF6838 family protein -
  EQI27_RS13270 (EQI27_13270) yqbI 2553993..2554496 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  EQI27_RS13275 (EQI27_13275) yqbH 2554493..2554855 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  EQI27_RS13280 (EQI27_13280) gkpG 2554852..2555247 (-) 396 WP_004398566.1 DUF3199 family protein -
  EQI27_RS13285 (EQI27_13285) yqbF 2555251..2555562 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  EQI27_RS13290 (EQI27_13290) skdG 2555573..2556508 (-) 936 WP_003229922.1 phage major capsid protein -
  EQI27_RS13295 (EQI27_13295) yqbD 2556527..2557495 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  EQI27_RS13300 (EQI27_13300) - 2557528..2558181 (-) 654 WP_003229920.1 hypothetical protein -
  EQI27_RS13305 (EQI27_13305) yqbB 2558222..2559139 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  EQI27_RS13310 (EQI27_13310) yqbA 2559136..2560668 (-) 1533 WP_004398894.1 phage portal protein -
  EQI27_RS13315 (EQI27_13315) stmB 2560672..2561967 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  EQI27_RS13320 (EQI27_13320) terS 2561960..2562679 (-) 720 WP_003229916.1 phage terminase small subunit -
  EQI27_RS13325 (EQI27_13325) - 2562747..2563211 (-) 465 WP_004398685.1 hypothetical protein -
  EQI27_RS13330 (EQI27_13330) yqaQ 2563355..2563810 (-) 456 WP_004398775.1 hypothetical protein -
  EQI27_RS13335 (EQI27_13335) - 2564008..2564937 (+) 930 WP_003229913.1 hypothetical protein -
  EQI27_RS13340 (EQI27_13340) yqaO 2565011..2565217 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  EQI27_RS13345 (EQI27_13345) yqaN 2565299..2565727 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  EQI27_RS13350 (EQI27_13350) - 2565823..2565972 (-) 150 WP_003229910.1 hypothetical protein -
  EQI27_RS13355 (EQI27_13355) sknM 2565963..2566904 (-) 942 WP_075058863.1 ATP-binding protein -
  EQI27_RS13360 (EQI27_13360) yqaL 2566786..2567463 (-) 678 WP_116362964.1 DnaD domain protein -
  EQI27_RS13365 (EQI27_13365) recT 2567539..2568393 (-) 855 WP_003229907.1 recombinase RecT -
  EQI27_RS13370 (EQI27_13370) yqaJ 2568396..2569355 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  EQI27_RS13375 (EQI27_13375) - 2569461..2569655 (-) 195 WP_003229905.1 hypothetical protein -
  EQI27_RS13380 (EQI27_13380) - 2569615..2569788 (-) 174 WP_119123069.1 hypothetical protein -
  EQI27_RS13385 (EQI27_13385) sknH 2569785..2570042 (-) 258 WP_003245994.1 YqaH family protein -
  EQI27_RS13390 (EQI27_13390) yqaG 2570039..2570608 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  EQI27_RS13395 (EQI27_13395) - 2570682..2570822 (-) 141 WP_003229902.1 hypothetical protein -
  EQI27_RS13400 (EQI27_13400) yqaF 2570852..2571082 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  EQI27_RS13405 (EQI27_13405) sknR 2571258..2571608 (+) 351 WP_004398704.1 transcriptional regulator SknR -
  EQI27_RS13410 (EQI27_13410) - 2571875..2572042 (-) 168 WP_003229900.1 hypothetical protein -
  EQI27_RS13415 (EQI27_13415) yqaC 2572398..2572934 (-) 537 WP_004399117.1 AAA family ATPase -
  EQI27_RS13420 (EQI27_13420) yqaB 2573203..2573721 (+) 519 WP_015714342.1 ImmA/IrrE family metallo-endopeptidase -
  EQI27_RS13425 (EQI27_13425) - 2573727..2574119 (+) 393 Protein_2604 sigma-70 family RNA polymerase sigma factor -
  EQI27_RS13430 (EQI27_13430) - 2574119..2574235 (+) 117 WP_041850087.1 hypothetical protein -
  EQI27_RS13435 (EQI27_13435) - 2574201..2574398 (-) 198 Protein_2606 recombinase family protein -
  EQI27_RS13440 (EQI27_13440) - 2574356..2574520 (-) 165 WP_080332536.1 hypothetical protein -
  EQI27_RS13445 (EQI27_13445) psiE 2575065..2575481 (-) 417 WP_003246154.1 phosphate-starvation-inducible protein PsiE -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=335131 EQI27_RS13075 WP_009967785.1 2524753..2525163(-) (nucA/comI) [Bacillus subtilis strain SRCM103923]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=335131 EQI27_RS13075 WP_009967785.1 2524753..2525163(-) (nucA/comI) [Bacillus subtilis strain SRCM103923]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAGCAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGATAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACG
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCTGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment