Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EQH95_RS16885 Genome accession   NZ_CP035162
Coordinates   3141688..3141828 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103886     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3136688..3146828
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH95_RS16860 (EQH95_16860) yuxO 3136965..3137345 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  EQH95_RS16865 (EQH95_16865) comA 3137364..3138008 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQH95_RS16870 (EQH95_16870) comP 3138089..3140401 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  EQH95_RS16875 (EQH95_16875) comX 3140417..3140638 (-) 222 WP_014480704.1 competence pheromone ComX -
  EQH95_RS16880 (EQH95_16880) - 3140640..3141503 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  EQH95_RS16885 (EQH95_16885) degQ 3141688..3141828 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQH95_RS16890 (EQH95_16890) - 3142050..3142175 (+) 126 WP_003228793.1 hypothetical protein -
  EQH95_RS16895 (EQH95_16895) - 3142290..3142658 (+) 369 WP_046381300.1 hypothetical protein -
  EQH95_RS16900 (EQH95_16900) pdeH 3142634..3143863 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  EQH95_RS16905 (EQH95_16905) pncB 3143999..3145471 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQH95_RS16910 (EQH95_16910) pncA 3145487..3146038 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  EQH95_RS16915 (EQH95_16915) yueI 3146135..3146533 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=335062 EQH95_RS16885 WP_003220708.1 3141688..3141828(-) (degQ) [Bacillus subtilis strain SRCM103886]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=335062 EQH95_RS16885 WP_003220708.1 3141688..3141828(-) (degQ) [Bacillus subtilis strain SRCM103886]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment