Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | EQH95_RS13850 | Genome accession | NZ_CP035162 |
| Coordinates | 2569587..2569997 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain SRCM103886 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2562691..2593887 | 2569587..2569997 | within | 0 |
Gene organization within MGE regions
Location: 2562691..2593887
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH95_RS13810 (EQH95_13810) | yqeH | 2562691..2563791 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| EQH95_RS13815 (EQH95_13815) | yqeG | 2563795..2564313 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| EQH95_RS13820 (EQH95_13820) | - | 2564675..2564815 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| EQH95_RS13825 (EQH95_13825) | yqeF | 2565121..2565852 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| EQH95_RS13830 (EQH95_13830) | cwlH | 2566104..2566856 (-) | 753 | WP_069837642.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| EQH95_RS13835 (EQH95_13835) | yqeD | 2567043..2567669 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| EQH95_RS13840 (EQH95_13840) | gnd | 2567688..2568581 (-) | 894 | WP_069837643.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| EQH95_RS13845 (EQH95_13845) | yqeB | 2568832..2569554 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| EQH95_RS13850 (EQH95_13850) | nucA/comI | 2569587..2569997 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| EQH95_RS13855 (EQH95_13855) | sigK | 2570193..2570921 (+) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| EQH95_RS13860 (EQH95_13860) | - | 2570921..2571019 (+) | 99 | WP_031600702.1 | hypothetical protein | - |
| EQH95_RS22965 | - | 2571016..2571228 (-) | 213 | Protein_2668 | recombinase family protein | - |
| EQH95_RS13870 (EQH95_13870) | fumC | 2571447..2572835 (-) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| EQH95_RS13875 (EQH95_13875) | - | 2573002..2573892 (+) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| EQH95_RS13880 (EQH95_13880) | - | 2574833..2575228 (+) | 396 | WP_014480327.1 | VOC family protein | - |
| EQH95_RS13890 (EQH95_13890) | - | 2575968..2577095 (-) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| EQH95_RS23145 (EQH95_13895) | - | 2577277..2579203 (+) | 1927 | Protein_2673 | T7SS effector LXG polymorphic toxin | - |
| EQH95_RS13900 (EQH95_13900) | - | 2579217..2579504 (+) | 288 | WP_014480331.1 | hypothetical protein | - |
| EQH95_RS13910 (EQH95_13910) | - | 2579907..2580347 (+) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| EQH95_RS13915 (EQH95_13915) | - | 2580446..2580898 (+) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| EQH95_RS13920 (EQH95_13920) | cdiI | 2580995..2581354 (+) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| EQH95_RS13925 (EQH95_13925) | - | 2581459..2581938 (+) | 480 | WP_224588637.1 | hypothetical protein | - |
| EQH95_RS13930 (EQH95_13930) | - | 2582242..2582445 (-) | 204 | WP_123772462.1 | hypothetical protein | - |
| EQH95_RS13935 (EQH95_13935) | - | 2582525..2582758 (+) | 234 | WP_224588641.1 | hypothetical protein | - |
| EQH95_RS13940 (EQH95_13940) | atxG | 2583015..2583592 (+) | 578 | Protein_2681 | suppressor of fused domain protein | - |
| EQH95_RS13945 (EQH95_13945) | - | 2583702..2583992 (+) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| EQH95_RS13955 (EQH95_13955) | istA | 2584833..2586380 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| EQH95_RS13960 (EQH95_13960) | istB | 2586377..2587135 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| EQH95_RS22985 | - | 2587453..2587550 (-) | 98 | Protein_2685 | N-acetylmuramoyl-L-alanine amidase | - |
| EQH95_RS13970 (EQH95_13970) | - | 2587728..2587814 (+) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| EQH95_RS23245 (EQH95_13975) | - | 2588101..2588537 (-) | 437 | Protein_2687 | phage tail tube protein | - |
| EQH95_RS22715 | terS | 2588535..2589100 (-) | 566 | Protein_2688 | phage terminase small subunit | - |
| EQH95_RS13985 (EQH95_13985) | - | 2589227..2589532 (+) | 306 | WP_123772463.1 | hypothetical protein | - |
| EQH95_RS23000 | - | 2589705..2589770 (-) | 66 | Protein_2690 | hypothetical protein | - |
| EQH95_RS13990 (EQH95_13990) | - | 2589925..2590404 (-) | 480 | WP_014480344.1 | hypothetical protein | - |
| EQH95_RS13995 (EQH95_13995) | - | 2591021..2591287 (+) | 267 | WP_033881358.1 | hypothetical protein | - |
| EQH95_RS14000 (EQH95_14000) | - | 2591426..2591578 (-) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| EQH95_RS14005 (EQH95_14005) | - | 2591661..2591783 (-) | 123 | Protein_2694 | RusA family crossover junction endodeoxyribonuclease | - |
| EQH95_RS14010 (EQH95_14010) | - | 2591746..2591994 (-) | 249 | Protein_2695 | hypothetical protein | - |
| EQH95_RS23005 | - | 2592139..2592369 (-) | 231 | WP_224588644.1 | hypothetical protein | - |
| EQH95_RS14020 (EQH95_14020) | - | 2592678..2592858 (-) | 181 | Protein_2697 | hypothetical protein | - |
| EQH95_RS14025 (EQH95_14025) | bltR | 2593066..2593887 (-) | 822 | WP_014480349.1 | multidrug efflux transcriptional regulator BltR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=335051 EQH95_RS13850 WP_009967785.1 2569587..2569997(-) (nucA/comI) [Bacillus subtilis strain SRCM103886]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=335051 EQH95_RS13850 WP_009967785.1 2569587..2569997(-) (nucA/comI) [Bacillus subtilis strain SRCM103886]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |