Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   EQH88_RS12770 Genome accession   NZ_CP035161
Coordinates   2456640..2457023 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103862     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2451640..2462023
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH88_RS12730 (EQH88_12730) sinI 2452574..2452747 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQH88_RS12735 (EQH88_12735) sinR 2452781..2453116 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQH88_RS12740 (EQH88_12740) tasA 2453209..2453994 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQH88_RS12745 (EQH88_12745) sipW 2454058..2454630 (-) 573 WP_072692741.1 signal peptidase I SipW -
  EQH88_RS12750 (EQH88_12750) tapA 2454614..2455375 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  EQH88_RS12755 (EQH88_12755) yqzG 2455646..2455972 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQH88_RS12760 (EQH88_12760) spoIITA 2456014..2456193 (-) 180 WP_029726723.1 YqzE family protein -
  EQH88_RS12765 (EQH88_12765) comGG 2456265..2456639 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  EQH88_RS12770 (EQH88_12770) comGF 2456640..2457023 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  EQH88_RS12775 (EQH88_12775) comGE 2457049..2457396 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  EQH88_RS12780 (EQH88_12780) comGD 2457380..2457811 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  EQH88_RS12785 (EQH88_12785) comGC 2457801..2458097 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  EQH88_RS12790 (EQH88_12790) comGB 2458111..2459148 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  EQH88_RS12795 (EQH88_12795) comGA 2459135..2460205 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQH88_RS12800 (EQH88_12800) - 2460418..2460615 (-) 198 WP_029726717.1 hypothetical protein -
  EQH88_RS12805 (EQH88_12805) corA 2460617..2461570 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=334963 EQH88_RS12770 WP_029726721.1 2456640..2457023(-) (comGF) [Bacillus subtilis strain SRCM103862]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=334963 EQH88_RS12770 WP_029726721.1 2456640..2457023(-) (comGF) [Bacillus subtilis strain SRCM103862]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment