Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EO946_RS15820 Genome accession   NZ_CP034943
Coordinates   3057966..3058106 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3052966..3063106
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EO946_RS15795 (EO946_15795) - 3053290..3053670 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  EO946_RS15800 (EO946_15800) comA 3053686..3054330 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EO946_RS15805 (EO946_15805) comP 3054411..3056735 (-) 2325 WP_003220714.1 histidine kinase Regulator
  EO946_RS15810 (EO946_15810) comX 3056743..3056907 (-) 165 WP_003220712.1 competence pheromone ComX -
  EO946_RS15815 (EO946_15815) - 3056920..3057780 (-) 861 WP_003220710.1 polyprenyl synthetase family protein -
  EO946_RS15820 (EO946_15820) degQ 3057966..3058106 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EO946_RS15825 (EO946_15825) - 3058338..3058454 (+) 117 WP_136975871.1 hypothetical protein -
  EO946_RS15830 (EO946_15830) - 3058569..3058937 (+) 369 WP_003220698.1 hypothetical protein -
  EO946_RS15835 (EO946_15835) pdeH 3058913..3060142 (-) 1230 WP_003220696.1 cyclic di-GMP phosphodiesterase -
  EO946_RS15840 (EO946_15840) - 3060277..3061749 (-) 1473 WP_003220693.1 nicotinate phosphoribosyltransferase -
  EO946_RS15845 (EO946_15845) - 3061765..3062316 (-) 552 WP_003220692.1 cysteine hydrolase family protein -
  EO946_RS15850 (EO946_15850) - 3062413..3062811 (-) 399 WP_003220689.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=333607 EO946_RS15820 WP_003220708.1 3057966..3058106(-) (degQ) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=333607 EO946_RS15820 WP_003220708.1 3057966..3058106(-) (degQ) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment