Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   SP70585_RS02955 Genome accession   NC_012468
Coordinates   543071..543220 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae 70585     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 540423..542204 543071..543220 flank 867


Gene organization within MGE regions


Location: 540423..543220
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SP70585_RS13100 - 540423..541237 (+) 815 Protein_564 IS5-like element IS1515 family transposase -
  SP70585_RS12205 - 541398..542204 (+) 807 Protein_565 IS5 family transposase -
  SP70585_RS02945 (SP70585_0600) blpM 542354..542608 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  SP70585_RS02950 (SP70585_0601) blpN 542624..542827 (+) 204 WP_001099491.1 two-peptide bacteriocin subunit BlpN -
  SP70585_RS02955 (SP70585_0602) cipB 543071..543220 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=33296 SP70585_RS02955 WP_001818346.1 543071..543220(+) (cipB) [Streptococcus pneumoniae 70585]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=33296 SP70585_RS02955 WP_001818346.1 543071..543220(+) (cipB) [Streptococcus pneumoniae 70585]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment