Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EKQ63_RS22695 Genome accession   NZ_CP034686
Coordinates   3946741..3947019 (-) Length   92 a.a.
NCBI ID   WP_073543801.1    Uniprot ID   -
Organism   Bacillus sp. BD59S     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3914159..3956735 3946741..3947019 within 0


Gene organization within MGE regions


Location: 3914159..3956735
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EKQ63_RS22485 (EKQ63_22465) - 3914159..3914809 (-) 651 WP_142385804.1 2OG-Fe(II) oxygenase -
  EKQ63_RS22490 (EKQ63_22470) comGG 3914985..3915356 (-) 372 WP_087954301.1 competence type IV pilus minor pilin ComGG -
  EKQ63_RS22495 (EKQ63_22475) - 3915353..3915664 (-) 312 WP_143881502.1 ComGF family competence protein -
  EKQ63_RS22500 (EKQ63_22480) - 3916131..3916484 (+) 354 WP_143881503.1 YolD-like family protein -
  EKQ63_RS22505 (EKQ63_22485) - 3916576..3916950 (+) 375 WP_143881504.1 hypothetical protein -
  EKQ63_RS22510 (EKQ63_22490) - 3917115..3918179 (-) 1065 WP_143881505.1 N-acetylmuramoyl-L-alanine amidase -
  EKQ63_RS22515 (EKQ63_22495) - 3918176..3918415 (-) 240 WP_123805348.1 holin -
  EKQ63_RS22520 (EKQ63_22500) - 3918415..3918651 (-) 237 WP_000398738.1 hemolysin XhlA family protein -
  EKQ63_RS22525 (EKQ63_22505) - 3918690..3923534 (-) 4845 WP_143881506.1 phage tail spike protein -
  EKQ63_RS22530 (EKQ63_22510) - 3923531..3925012 (-) 1482 WP_143881507.1 distal tail protein Dit -
  EKQ63_RS22535 (EKQ63_22515) - 3925054..3927480 (-) 2427 WP_143881508.1 hypothetical protein -
  EKQ63_RS22540 (EKQ63_22520) - 3927738..3928946 (-) 1209 Protein_4034 DUF2207 domain-containing protein -
  EKQ63_RS22545 (EKQ63_22525) - 3929177..3929533 (-) 357 WP_143881509.1 hypothetical protein -
  EKQ63_RS22550 (EKQ63_22530) - 3929540..3930127 (-) 588 WP_073543549.1 major tail protein -
  EKQ63_RS22555 (EKQ63_22535) - 3930128..3930457 (-) 330 WP_143881510.1 hypothetical protein -
  EKQ63_RS22560 (EKQ63_22540) - 3930457..3930798 (-) 342 WP_143881511.1 HK97 gp10 family phage protein -
  EKQ63_RS22565 (EKQ63_22545) - 3930800..3931153 (-) 354 WP_033693390.1 phage head closure protein -
  EKQ63_RS22570 (EKQ63_22550) - 3931155..3931448 (-) 294 WP_143881512.1 hypothetical protein -
  EKQ63_RS22575 (EKQ63_22555) - 3931461..3932624 (-) 1164 WP_143881513.1 phage major capsid protein -
  EKQ63_RS22580 (EKQ63_22560) - 3932644..3933426 (-) 783 WP_143881514.1 head maturation protease, ClpP-related -
  EKQ63_RS22585 (EKQ63_22565) - 3933410..3934516 (-) 1107 WP_050511386.1 phage portal protein -
  EKQ63_RS22590 (EKQ63_22570) - 3934582..3936240 (-) 1659 WP_143881515.1 terminase TerL endonuclease subunit -
  EKQ63_RS22595 (EKQ63_22575) - 3936237..3936572 (-) 336 WP_143881516.1 P27 family phage terminase small subunit -
  EKQ63_RS22600 (EKQ63_22580) - 3936725..3937060 (-) 336 WP_143881517.1 HNH endonuclease -
  EKQ63_RS22605 (EKQ63_22585) - 3937057..3937272 (-) 216 WP_073543712.1 hypothetical protein -
  EKQ63_RS22610 (EKQ63_22590) - 3937273..3937497 (-) 225 WP_143881518.1 hypothetical protein -
  EKQ63_RS29975 - 3937494..3937667 (-) 174 WP_190240621.1 hypothetical protein -
  EKQ63_RS30390 - 3937707..3938072 (-) 366 WP_223290770.1 hypothetical protein -
  EKQ63_RS22620 (EKQ63_22600) - 3938464..3939102 (-) 639 WP_143881519.1 hypothetical protein -
  EKQ63_RS22625 (EKQ63_22605) - 3939320..3939862 (-) 543 WP_001012146.1 site-specific integrase -
  EKQ63_RS22630 (EKQ63_22610) - 3939862..3940344 (-) 483 WP_098487824.1 ArpU family phage packaging/lysis transcriptional regulator -
  EKQ63_RS29980 - 3940372..3940542 (-) 171 WP_081366284.1 hypothetical protein -
  EKQ63_RS22635 (EKQ63_22615) - 3940647..3940829 (-) 183 WP_143881520.1 hypothetical protein -
  EKQ63_RS22640 (EKQ63_22620) - 3940850..3940972 (-) 123 WP_048539310.1 DUF3983 domain-containing protein -
  EKQ63_RS22645 (EKQ63_22625) - 3940996..3941295 (-) 300 WP_143881521.1 hypothetical protein -
  EKQ63_RS29985 - 3941322..3941489 (-) 168 WP_176520097.1 hypothetical protein -
  EKQ63_RS22650 (EKQ63_22630) - 3941563..3941796 (-) 234 WP_143881522.1 hypothetical protein -
  EKQ63_RS30395 - 3941833..3942760 (-) 928 Protein_4060 DNA cytosine methyltransferase -
  EKQ63_RS22665 (EKQ63_22645) - 3942804..3944183 (-) 1380 WP_143881523.1 DNA cytosine methyltransferase -
  EKQ63_RS29990 - 3944231..3944386 (-) 156 WP_190240622.1 hypothetical protein -
  EKQ63_RS22670 (EKQ63_22650) - 3944427..3945146 (-) 720 WP_143881524.1 hypothetical protein -
  EKQ63_RS22675 (EKQ63_22655) - 3945397..3945906 (-) 510 WP_143881525.1 dUTP diphosphatase -
  EKQ63_RS22680 (EKQ63_22660) - 3945926..3946177 (-) 252 WP_074565272.1 helix-turn-helix domain containing protein -
  EKQ63_RS22685 (EKQ63_22665) - 3946203..3946370 (-) 168 WP_000717826.1 DUF3954 domain-containing protein -
  EKQ63_RS22690 (EKQ63_22670) - 3946389..3946748 (-) 360 WP_143881526.1 cell division protein SepF -
  EKQ63_RS22695 (EKQ63_22675) abrB 3946741..3947019 (-) 279 WP_073543801.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EKQ63_RS22700 (EKQ63_22680) - 3947036..3947230 (-) 195 WP_143881527.1 hypothetical protein -
  EKQ63_RS22705 (EKQ63_22685) - 3947265..3948140 (-) 876 WP_143881528.1 DnaA ATPase domain-containing protein -
  EKQ63_RS22710 (EKQ63_22690) - 3948082..3948930 (-) 849 WP_000852573.1 phage replisome organizer N-terminal domain-containing protein -
  EKQ63_RS29995 - 3948936..3949112 (-) 177 WP_000364156.1 hypothetical protein -
  EKQ63_RS30000 - 3949142..3949306 (-) 165 WP_190240623.1 hypothetical protein -
  EKQ63_RS22715 (EKQ63_22695) - 3949319..3949579 (-) 261 WP_000626615.1 hypothetical protein -
  EKQ63_RS22720 (EKQ63_22700) - 3949613..3950344 (-) 732 WP_143881529.1 ORF6C domain-containing protein -
  EKQ63_RS22725 (EKQ63_22705) - 3950307..3950585 (-) 279 WP_143881530.1 helix-turn-helix domain-containing protein -
  EKQ63_RS22730 (EKQ63_22710) - 3950840..3951184 (+) 345 WP_074602597.1 helix-turn-helix domain-containing protein -
  EKQ63_RS30515 - 3951198..3951320 (-) 123 WP_263053820.1 hypothetical protein -
  EKQ63_RS30005 - 3951450..3951602 (-) 153 WP_190240624.1 hypothetical protein -
  EKQ63_RS22735 (EKQ63_22715) - 3951635..3952777 (-) 1143 WP_143881531.1 AimR family lysis-lysogeny pheromone receptor -
  EKQ63_RS22740 (EKQ63_22720) - 3953272..3953616 (+) 345 WP_143881532.1 helix-turn-helix domain-containing protein -
  EKQ63_RS22745 (EKQ63_22725) - 3953809..3954177 (+) 369 WP_143881533.1 hypothetical protein -
  EKQ63_RS30520 - 3954220..3954345 (-) 126 WP_263053821.1 hypothetical protein -
  EKQ63_RS22750 (EKQ63_22730) - 3954515..3955684 (+) 1170 WP_143881534.1 site-specific integrase -
  EKQ63_RS30525 (EKQ63_22735) - 3955827..3956015 (-) 189 Protein_4085 prepilin-type N-terminal cleavage/methylation domain-containing protein -
  EKQ63_RS22760 (EKQ63_22740) comGE 3955985..3956287 (-) 303 WP_143881781.1 competence type IV pilus minor pilin ComGE -
  EKQ63_RS22765 (EKQ63_22745) comGD 3956280..3956735 (-) 456 WP_087954300.1 comG operon protein ComGD -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10193.83 Da        Isoelectric Point: 5.7427

>NTDB_id=332499 EKQ63_RS22695 WP_073543801.1 3946741..3947019(-) (abrB) [Bacillus sp. BD59S]
MKNTGVARKVDELGRVVIPIELRRNLGIIEGTALGFHVEGENIVLRKQEKSCFVTGEVSESNMELLDGRMFLSKEGATEL
LDILEKSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=332499 EKQ63_RS22695 WP_073543801.1 3946741..3947019(-) (abrB) [Bacillus sp. BD59S]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGATGAGCTAGGGCGAGTGGTAATTCCAATAGAGTTACGCAGAAATTTGGG
GATTATTGAAGGAACGGCACTAGGCTTTCATGTCGAGGGTGAAAACATTGTTTTAAGAAAACAAGAAAAGTCATGCTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGCTGGACGGACGAATGTTTTTGAGCAAGGAAGGGGCAACTGAATTG
CTGGACATTCTTGAAAAGAGTGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

57.831

90.217

0.522

Multiple sequence alignment