Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   SPP_RS02730 Genome accession   NC_012467
Coordinates   504878..505027 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae P1031     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 499878..510027
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPP_RS02705 (SPP_0550) blpC 500142..500297 (-) 156 WP_000358812.1 quorum-sensing system pheromone BlpC -
  SPP_RS02710 (SPP_0551) - 500354..501715 (-) 1362 WP_001069063.1 bacteriocin secretion accessory protein -
  SPP_RS02715 (SPP_0552) comA/nlmT 501726..503879 (-) 2154 WP_000205160.1 peptide cleavage/export ABC transporter BlpA Regulator
  SPP_RS02720 (SPP_0553) blpM 504161..504415 (+) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  SPP_RS02725 (SPP_0554) blpN 504431..504634 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  SPP_RS02730 (SPP_0555) cipB 504878..505027 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  SPP_RS02735 (SPP_0557) - 505131..505250 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  SPP_RS02750 (SPP_0560) - 505718..506089 (+) 372 WP_001810529.1 hypothetical protein -
  SPP_RS02760 (SPP_0563) - 506718..507101 (+) 384 WP_000877381.1 hypothetical protein -
  SPP_RS02765 (SPP_0564) - 507153..507842 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  SPP_RS02770 (SPP_0565) blpZ 507884..508117 (+) 234 WP_000276498.1 immunity protein BlpZ -
  SPP_RS02775 (SPP_0566) - 508268..508879 (+) 612 WP_000394048.1 CPBP family intramembrane glutamic endopeptidase -
  SPP_RS02780 (SPP_0567) ccrZ 509040..509834 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=33218 SPP_RS02730 WP_001809846.1 504878..505027(+) (cipB) [Streptococcus pneumoniae P1031]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=33218 SPP_RS02730 WP_001809846.1 504878..505027(+) (cipB) [Streptococcus pneumoniae P1031]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment