Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   EJ992_RS18265 Genome accession   NZ_CP034569
Coordinates   3490078..3490362 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain ATCC 14580     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3441589..3495235 3490078..3490362 within 0


Gene organization within MGE regions


Location: 3441589..3495235
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJ992_RS17960 (EJ992_17960) - 3442842..3443060 (-) 219 WP_011198294.1 transcriptional regulator -
  EJ992_RS17965 (EJ992_17965) - 3443287..3443856 (+) 570 WP_011198295.1 hypothetical protein -
  EJ992_RS17970 (EJ992_17970) - 3444101..3444193 (-) 93 Protein_3499 peptidoglycan-binding domain-containing protein -
  EJ992_RS17980 (EJ992_17975) - 3444373..3444603 (-) 231 WP_011198296.1 helix-turn-helix domain-containing protein -
  EJ992_RS22115 - 3444858..3445001 (-) 144 WP_021837703.1 hypothetical protein -
  EJ992_RS17985 (EJ992_17980) - 3445108..3446130 (-) 1023 WP_011198298.1 hypothetical protein -
  EJ992_RS17990 (EJ992_17985) - 3446401..3447930 (+) 1530 WP_011198299.1 T7SS effector LXG polymorphic toxin -
  EJ992_RS17995 (EJ992_17990) - 3447946..3448284 (+) 339 WP_011198300.1 hypothetical protein -
  EJ992_RS18000 (EJ992_17995) - 3448341..3449420 (-) 1080 WP_011198301.1 N-acetylmuramoyl-L-alanine amidase -
  EJ992_RS18005 (EJ992_18000) - 3449472..3449735 (-) 264 WP_011198302.1 phage holin -
  EJ992_RS18010 (EJ992_18005) - 3449751..3450020 (-) 270 WP_009329192.1 hemolysin XhlA family protein -
  EJ992_RS18015 (EJ992_18010) - 3450083..3450265 (-) 183 WP_011198303.1 XkdX family protein -
  EJ992_RS18020 (EJ992_18015) - 3450262..3450576 (-) 315 WP_011198304.1 hypothetical protein -
  EJ992_RS18025 (EJ992_18020) - 3450588..3451931 (-) 1344 WP_011198305.1 phage baseplate upper protein -
  EJ992_RS18030 (EJ992_18025) - 3451952..3453907 (-) 1956 WP_011198306.1 right-handed parallel beta-helix repeat-containing protein -
  EJ992_RS18035 (EJ992_18030) - 3453944..3455656 (-) 1713 WP_003185331.1 phage tail protein -
  EJ992_RS18040 (EJ992_18035) - 3455669..3456505 (-) 837 WP_011198307.1 phage tail family protein -
  EJ992_RS18045 (EJ992_18040) - 3456505..3460971 (-) 4467 WP_011198308.1 phage tail tape measure protein -
  EJ992_RS18050 (EJ992_18045) gpG 3461180..3461542 (-) 363 WP_003185339.1 phage tail assembly chaperone G -
  EJ992_RS18055 (EJ992_18050) - 3461596..3462213 (-) 618 WP_003185341.1 major tail protein -
  EJ992_RS18060 (EJ992_18055) - 3462228..3462611 (-) 384 WP_003185344.1 hypothetical protein -
  EJ992_RS18065 (EJ992_18060) - 3462608..3463006 (-) 399 WP_006637249.1 HK97-gp10 family putative phage morphogenesis protein -
  EJ992_RS18070 (EJ992_18065) - 3463006..3463314 (-) 309 WP_003185349.1 phage head closure protein -
  EJ992_RS18075 (EJ992_18070) - 3463304..3463606 (-) 303 WP_003185351.1 head-tail connector protein -
  EJ992_RS18080 (EJ992_18075) - 3463627..3464052 (-) 426 WP_011198310.1 collagen-like protein -
  EJ992_RS18085 (EJ992_18080) - 3464075..3465358 (-) 1284 WP_011198311.1 phage major capsid protein -
  EJ992_RS18090 (EJ992_18085) - 3465398..3466129 (-) 732 WP_011201736.1 head maturation protease, ClpP-related -
  EJ992_RS18095 (EJ992_18090) - 3466074..3467384 (-) 1311 WP_003185359.1 phage portal protein -
  EJ992_RS18100 (EJ992_18095) - 3467385..3467576 (-) 192 WP_003185361.1 DUF1056 family protein -
  EJ992_RS18105 (EJ992_18100) - 3467588..3469297 (-) 1710 WP_003185362.1 terminase large subunit -
  EJ992_RS18110 (EJ992_18105) - 3469294..3469809 (-) 516 WP_011198313.1 phage terminase small subunit P27 family -
  EJ992_RS18120 (EJ992_18115) - 3470040..3470414 (-) 375 WP_011198314.1 HNH endonuclease -
  EJ992_RS18125 (EJ992_18120) - 3470441..3470749 (-) 309 WP_041817053.1 hypothetical protein -
  EJ992_RS18130 (EJ992_18125) cotD 3470966..3471190 (-) 225 WP_006637235.1 spore coat protein CotD -
  EJ992_RS18135 (EJ992_18130) - 3471929..3472309 (-) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  EJ992_RS18140 (EJ992_18135) - 3472436..3472708 (-) 273 WP_011198316.1 DUF5052 family protein -
  EJ992_RS18145 (EJ992_18140) - 3472778..3473206 (-) 429 WP_011201737.1 putative metallopeptidase -
  EJ992_RS22475 - 3473169..3473291 (-) 123 WP_257227968.1 hypothetical protein -
  EJ992_RS18150 (EJ992_18145) - 3473294..3473464 (-) 171 WP_009329251.1 Fur-regulated basic protein FbpA -
  EJ992_RS18155 (EJ992_18150) - 3473461..3474000 (-) 540 WP_009329253.1 ERCC4 domain-containing protein -
  EJ992_RS18160 (EJ992_18155) - 3473997..3474434 (-) 438 WP_011198317.1 hypothetical protein -
  EJ992_RS18165 (EJ992_18160) - 3474412..3474783 (-) 372 WP_011198318.1 hypothetical protein -
  EJ992_RS18170 (EJ992_18165) - 3475159..3477576 (-) 2418 WP_011198319.1 phage/plasmid primase, P4 family -
  EJ992_RS18175 (EJ992_18170) - 3477637..3478074 (-) 438 WP_009329263.1 DUF669 domain-containing protein -
  EJ992_RS18180 (EJ992_18175) - 3478074..3479006 (-) 933 WP_011198320.1 AAA family ATPase -
  EJ992_RS18185 (EJ992_18180) - 3479010..3479567 (-) 558 WP_011198321.1 host-nuclease inhibitor Gam family protein -
  EJ992_RS18190 (EJ992_18185) - 3479660..3479902 (-) 243 WP_011198322.1 hypothetical protein -
  EJ992_RS18195 (EJ992_18190) - 3479990..3480256 (-) 267 WP_011198324.1 YqaH family protein -
  EJ992_RS18200 (EJ992_18195) - 3480316..3480696 (+) 381 WP_011198325.1 DUF2513 domain-containing protein -
  EJ992_RS22120 - 3480688..3480858 (-) 171 WP_011198326.1 hypothetical protein -
  EJ992_RS18205 (EJ992_18200) - 3481202..3481756 (-) 555 WP_003185401.1 hypothetical protein -
  EJ992_RS18210 (EJ992_18205) - 3481814..3482002 (-) 189 WP_016886536.1 hypothetical protein -
  EJ992_RS18215 (EJ992_18210) - 3482134..3482322 (-) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  EJ992_RS18220 (EJ992_18215) - 3482319..3483113 (-) 795 WP_011198327.1 ORF6N domain-containing protein -
  EJ992_RS22655 (EJ992_18220) - 3483137..3483295 (-) 159 WP_374939103.1 XRE family transcriptional regulator -
  EJ992_RS18230 (EJ992_18225) - 3483533..3484171 (+) 639 WP_011198328.1 LexA family protein -
  EJ992_RS18235 (EJ992_18230) - 3484242..3485336 (+) 1095 WP_003185410.1 tyrosine-type recombinase/integrase -
  EJ992_RS18245 (EJ992_18240) smpB 3485888..3486361 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  EJ992_RS18250 (EJ992_18245) rnr 3486473..3488776 (-) 2304 WP_003185414.1 ribonuclease R -
  EJ992_RS18255 (EJ992_18250) - 3488790..3489536 (-) 747 WP_011198329.1 alpha/beta hydrolase -
  EJ992_RS18260 (EJ992_18255) secG 3489677..3489907 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  EJ992_RS18265 (EJ992_18260) abrB 3490078..3490362 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  EJ992_RS18270 (EJ992_18265) - 3490391..3490624 (-) 234 WP_085959538.1 helix-turn-helix domain-containing protein -
  EJ992_RS18275 (EJ992_18270) - 3490777..3491178 (+) 402 WP_009329609.1 transcriptional regulator -
  EJ992_RS18280 (EJ992_18275) - 3491350..3491748 (+) 399 WP_009329610.1 helix-turn-helix domain-containing protein -
  EJ992_RS18285 (EJ992_18280) - 3491796..3492473 (-) 678 WP_003185432.1 ABC transporter permease -
  EJ992_RS18290 (EJ992_18285) opuCC 3492490..3493407 (-) 918 WP_009329611.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  EJ992_RS18295 (EJ992_18290) - 3493421..3494074 (-) 654 WP_009329612.1 ABC transporter permease -
  EJ992_RS18300 (EJ992_18295) - 3494096..3495235 (-) 1140 WP_003185439.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=332016 EJ992_RS18265 WP_003185421.1 3490078..3490362(-) (abrB) [Bacillus licheniformis strain ATCC 14580]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=332016 EJ992_RS18265 WP_003185421.1 3490078..3490362(-) (abrB) [Bacillus licheniformis strain ATCC 14580]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543

Multiple sequence alignment