Detailed information NTG0331702

Bioinformatically predicted

Overview

• Name: comS
• Type: Regulator
• Locus tag: EJJ34_RS22945
• Genome accession: NZ_CP034484
• Coordinates: 390478..390618 (+)
• Length: 46 a.a.
• NCBI ID: WP_010886404.1
• Uniprot ID: A0AAX3RTW8
• Organism: Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610
• Function: preventing the degradation of ComK (predicted from homology) Competence regulation

Genomic Context

Location: 385478..395618

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EJJ34_RS22940	srfAB	387342..390434 (+)	3093	Protein_353	surfactin non-ribosomal peptide synthetase SrfAB	-
EJJ34_RS22945	comS	390478..390618 (+)	141	WP_010886404.1	competence protein ComS	Regulator

Sequence

Protein

• Length: 46 a.a.
• Molecular weight: 5244.05 Da
• Isoelectric Point: 9.2422

>NTDB_id=331702 EJJ34_RS22945 WP_010886404.1 390478..390618(+) (comS) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWREK

Nucleotide

• Length: 141 bp

>NTDB_id=331702 EJJ34_RS22945 WP_010886404.1 390478..390618(+) (comS) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
TTGAACCGATCAGGCAAGCATCTTATCAGCAGCATTATCCTGTATCCCCGGCCCAGCGGAGAATGTATATCCTCAATCAG
CTTGGACAAGCAAACACAAGCTACAACGTCCCCGCTGTACTTCTGCTGGAGGGAGAAGTAG

Domains

Predicted by InterproScan.

• Bacillus competence protein S (ComS) (1-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comS	Bacillus subtilis subsp. subtilis str. 168	100	100	1