Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   EJJ34_RS06305 Genome accession   NZ_CP034484
Coordinates   1207196..1207387 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1202196..1212387
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJJ34_RS06275 (EJJ34_06275) argF 1203060..1204019 (+) 960 WP_003232980.1 ornithine carbamoyltransferase -
  EJJ34_RS06280 (EJJ34_06280) yjzC 1204105..1204284 (+) 180 WP_003245356.1 YjzC family protein -
  EJJ34_RS06285 (EJJ34_06285) yjzD 1204330..1204515 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  EJJ34_RS06290 (EJJ34_06290) - 1204764..1205498 (+) 735 WP_003245223.1 hypothetical protein -
  EJJ34_RS06295 (EJJ34_06295) - 1205580..1206137 (+) 558 WP_003232974.1 hypothetical protein -
  EJJ34_RS06300 (EJJ34_06300) med 1206228..1207181 (+) 954 WP_003245494.1 transcriptional regulator Med Regulator
  EJJ34_RS06305 (EJJ34_06305) comZ 1207196..1207387 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  EJJ34_RS06310 (EJJ34_06310) yjzB 1207417..1207656 (-) 240 WP_003232972.1 spore coat protein YjzB -
  EJJ34_RS06315 (EJJ34_06315) fabH 1207821..1208759 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  EJJ34_RS06320 (EJJ34_06320) fabF 1208782..1210023 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  EJJ34_RS06325 (EJJ34_06325) yjaZ 1210099..1210884 (+) 786 WP_003232967.1 DUF2268 domain-containing protein -
  EJJ34_RS06330 (EJJ34_06330) appD 1211076..1212062 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=331643 EJJ34_RS06305 WP_003224559.1 1207196..1207387(+) (comZ) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=331643 EJJ34_RS06305 WP_003224559.1 1207196..1207387(+) (comZ) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterProScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment