Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   EJJ34_RS00245 Genome accession   NZ_CP034484
Coordinates   44439..44729 (-) Length   96 a.a.
NCBI ID   WP_003226760.1    Uniprot ID   A0A7G9PCZ4
Organism   Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context


Location: 39439..49729
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJJ34_RS00205 (EJJ34_00205) darA 39462..39791 (+) 330 WP_003242755.1 cyclic di-AMP receptor DarA -
  EJJ34_RS00210 (EJJ34_00210) yaaR 39804..40244 (+) 441 WP_009966249.1 YaaR family protein -
  EJJ34_RS00215 (EJJ34_00215) holB 40256..41245 (+) 990 WP_003244417.1 DNA polymerase III subunit delta' -
  EJJ34_RS00220 (EJJ34_00220) ricT 41248..42075 (+) 828 WP_003243571.1 competence/sporulation regulator complex protein RicT -
  EJJ34_RS00225 (EJJ34_00225) yabA 42090..42449 (+) 360 WP_003218308.1 replication initiation-control protein YabA -
  EJJ34_RS00230 (EJJ34_00230) trmNF 42508..43251 (+) 744 WP_003244526.1 tRNA1(Val) (adenine(37)-N6)-methyltransferase -
  EJJ34_RS00235 (EJJ34_00235) yazA 43238..43537 (+) 300 WP_003242983.1 GIY-YIG nuclease family protein -
  EJJ34_RS00240 (EJJ34_00240) rsmI 43512..44390 (+) 879 WP_003243457.1 16S rRNA (cytidine(1402)-2'-O)-methyltransferase -
  EJJ34_RS00245 (EJJ34_00245) abrB 44439..44729 (-) 291 WP_003226760.1 transition state genes transcriptional regulator AbrB Regulator
  EJJ34_RS00250 (EJJ34_00250) metG 45224..47218 (+) 1995 WP_003226758.1 methionine--tRNA ligase -
  EJJ34_RS00255 (EJJ34_00255) dayD 47297..48064 (+) 768 WP_003226756.1 TatD family hydrolase -
  EJJ34_RS00260 (EJJ34_00260) yabE 48220..49533 (+) 1314 WP_003226754.1 ubiquitin-like domain-containing protein -

Sequence


Protein


Download         Length: 96 a.a.        Molecular weight: 10772.62 Da        Isoelectric Point: 6.3482

>NTDB_id=331619 EJJ34_RS00245 WP_003226760.1 44439..44729(-) (abrB) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK

Nucleotide


Download         Length: 291 bp        

>NTDB_id=331619 EJJ34_RS00245 WP_003226760.1 44439..44729(-) (abrB) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTTATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATCTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGATGATAACCTTAAACTTGCAGGCGGTAAATTGGTTCTTAGTAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7G9PCZ4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment