Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPSJM_RS00205 Genome accession   NC_014560
Coordinates   37633..37746 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori SJM180     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32633..42746
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSJM_RS00180 (HPSJM_00185) - 32683..34911 (+) 2229 WP_000357227.1 AAA family ATPase -
  HPSJM_RS00185 (HPSJM_00190) panD 34901..35254 (+) 354 WP_000142271.1 aspartate 1-decarboxylase -
  HPSJM_RS00190 (HPSJM_00195) - 35257..35559 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HPSJM_RS00195 (HPSJM_00200) - 35559..36554 (+) 996 WP_000468426.1 PDZ domain-containing protein -
  HPSJM_RS00200 (HPSJM_00205) comB6 36562..37617 (+) 1056 WP_000679750.1 type IV secretion system protein Machinery gene
  HPSJM_RS00205 (HPSJM_00210) comB7 37633..37746 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPSJM_RS00210 (HPSJM_00215) comB8 37743..38486 (+) 744 WP_001208399.1 type IV secretion system protein Machinery gene
  HPSJM_RS00215 (HPSJM_00220) comB9 38486..39466 (+) 981 WP_013356315.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSJM_RS00220 (HPSJM_00225) comB10 39459..40595 (+) 1137 WP_001045850.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSJM_RS00225 (HPSJM_00230) - 40665..42077 (+) 1413 WP_000694792.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=33089 HPSJM_RS00205 WP_001217873.1 37633..37746(+) (comB7) [Helicobacter pylori SJM180]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=33089 HPSJM_RS00205 WP_001217873.1 37633..37746(+) (comB7) [Helicobacter pylori SJM180]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment