Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EBA29_RS14900 Genome accession   NZ_CP034203
Coordinates   3039333..3039473 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 83     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3034333..3044473
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EBA29_RS14875 (EBA29_03052) - 3034673..3035056 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  EBA29_RS14880 (EBA29_03053) comA 3035078..3035722 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  EBA29_RS14885 (EBA29_03054) comP 3035803..3038094 (-) 2292 WP_015387784.1 histidine kinase Regulator
  EBA29_RS14890 (EBA29_03055) comX 3038106..3038270 (-) 165 WP_007613432.1 competence pheromone ComX -
  EBA29_RS14895 (EBA29_03056) - 3038270..3039148 (-) 879 WP_225513875.1 polyprenyl synthetase family protein -
  EBA29_RS14900 (EBA29_03057) degQ 3039333..3039473 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  EBA29_RS14910 (EBA29_03059) - 3039939..3040280 (+) 342 WP_014418765.1 hypothetical protein -
  EBA29_RS14915 (EBA29_03060) - 3040287..3041510 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  EBA29_RS14920 (EBA29_03061) - 3041640..3043106 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  EBA29_RS14925 (EBA29_03062) - 3043124..3043675 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  EBA29_RS14930 (EBA29_03063) - 3043772..3044170 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=329822 EBA29_RS14900 WP_003152043.1 3039333..3039473(-) (degQ) [Bacillus velezensis strain 83]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=329822 EBA29_RS14900 WP_003152043.1 3039333..3039473(-) (degQ) [Bacillus velezensis strain 83]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment