Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EBA29_RS11780 | Genome accession | NZ_CP034203 |
| Coordinates | 2457494..2457667 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain 83 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2452494..2462667
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EBA29_RS11765 (EBA29_02410) | gcvT | 2453307..2454407 (-) | 1101 | WP_021494308.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| EBA29_RS11770 (EBA29_02411) | - | 2454831..2456501 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| EBA29_RS11775 (EBA29_02412) | - | 2456523..2457317 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| EBA29_RS11780 (EBA29_02413) | sinI | 2457494..2457667 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| EBA29_RS11785 (EBA29_02414) | sinR | 2457701..2458036 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| EBA29_RS11790 (EBA29_02415) | - | 2458084..2458869 (-) | 786 | WP_128496719.1 | TasA family protein | - |
| EBA29_RS11795 (EBA29_02416) | - | 2458934..2459518 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| EBA29_RS11800 (EBA29_02417) | tapA | 2459490..2460161 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EBA29_RS11805 (EBA29_02419) | - | 2460420..2460749 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| EBA29_RS11810 (EBA29_02420) | - | 2460790..2460969 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| EBA29_RS11815 (EBA29_02421) | comGG | 2461026..2461403 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| EBA29_RS11820 (EBA29_02422) | comGF | 2461404..2461799 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| EBA29_RS11825 (EBA29_02423) | comGE | 2461813..2462127 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| EBA29_RS11830 (EBA29_02424) | comGD | 2462111..2462548 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=329800 EBA29_RS11780 WP_014418369.1 2457494..2457667(+) (sinI) [Bacillus velezensis strain 83]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=329800 EBA29_RS11780 WP_014418369.1 2457494..2457667(+) (sinI) [Bacillus velezensis strain 83]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |