Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BVMH_RS16000 Genome accession   NZ_CP034176
Coordinates   3202830..3202970 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain MH25     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3197830..3207970
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVMH_RS15975 (BVMH_15975) - 3198175..3198558 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  BVMH_RS15980 (BVMH_15980) - 3198580..3199225 (-) 646 Protein_3078 response regulator transcription factor -
  BVMH_RS15985 (BVMH_15985) comP 3199306..3201606 (-) 2301 WP_124935036.1 histidine kinase Regulator
  BVMH_RS15990 (BVMH_15990) comX 3201620..3201793 (-) 174 WP_012118314.1 competence pheromone ComX -
  BVMH_RS15995 (BVMH_15995) - 3201762..3202622 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  BVMH_RS16000 (BVMH_16000) degQ 3202830..3202970 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BVMH_RS16010 (BVMH_16010) - 3203433..3203774 (+) 342 WP_007408677.1 hypothetical protein -
  BVMH_RS16015 (BVMH_16015) - 3203781..3205004 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BVMH_RS16020 (BVMH_16020) - 3205134..3206600 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  BVMH_RS16025 (BVMH_16025) - 3206618..3207169 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BVMH_RS16030 (BVMH_16030) - 3207266..3207664 (-) 399 WP_015240486.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=329647 BVMH_RS16000 WP_003152043.1 3202830..3202970(-) (degQ) [Bacillus velezensis strain MH25]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=329647 BVMH_RS16000 WP_003152043.1 3202830..3202970(-) (degQ) [Bacillus velezensis strain MH25]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment