Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   FGF55_RS01950 Genome accession   NZ_CP041691
Coordinates   390303..390422 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain ZJU1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 385303..395422
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGF55_RS01935 (FGF55_01935) - 386915..387598 (+) 684 WP_014416901.1 response regulator transcription factor -
  FGF55_RS01940 (FGF55_01940) - 387585..389012 (+) 1428 WP_088056326.1 HAMP domain-containing sensor histidine kinase -
  FGF55_RS01945 (FGF55_01945) rapC 389171..390319 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  FGF55_RS01950 (FGF55_01950) phrC 390303..390422 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  FGF55_RS01955 (FGF55_01955) - 390573..390668 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  FGF55_RS01960 (FGF55_01960) - 390763..392127 (-) 1365 WP_014416903.1 aspartate kinase -
  FGF55_RS01965 (FGF55_01965) ceuB 392541..393494 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  FGF55_RS01970 (FGF55_01970) - 393484..394431 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  FGF55_RS01975 (FGF55_01975) - 394425..395183 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=327992 FGF55_RS01950 WP_003156334.1 390303..390422(+) (phrC) [Bacillus amyloliquefaciens strain ZJU1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=327992 FGF55_RS01950 WP_003156334.1 390303..390422(+) (phrC) [Bacillus amyloliquefaciens strain ZJU1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718