Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPN23F_RS02490 | Genome accession | NC_011900 |
| Coordinates | 472394..472543 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae ATCC 700669 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 467394..477543
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPN23F_RS02465 (SPN23F04810) | comA/nlmT | 468461..470137 (-) | 1677 | WP_196300924.1 | peptide cleavage/export ABC transporter | Regulator |
| SPN23F_RS14160 (SPN23F04820) | comA/nlmT | 470031..470618 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| SPN23F_RS02475 (SPN23F04830) | blpI | 470900..471097 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| SPN23F_RS02480 (SPN23F04840) | blpJ | 471564..471833 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| SPN23F_RS02485 (SPN23F04850) | blpK | 471902..472150 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| SPN23F_RS02490 | cipB | 472394..472543 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| SPN23F_RS14245 | - | 472579..472644 (+) | 66 | Protein_477 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| SPN23F_RS02495 (SPN23F04880) | - | 472647..472766 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SPN23F_RS02510 (SPN23F04910) | - | 473247..473605 (+) | 359 | Protein_479 | immunity protein | - |
| SPN23F_RS02520 (SPN23F04930) | - | 474234..474617 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| SPN23F_RS02525 (SPN23F04940) | - | 474669..475358 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPN23F_RS02530 (SPN23F04941) | blpZ | 475400..475633 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| SPN23F_RS02535 (SPN23F04950) | - | 475784..476395 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPN23F_RS02540 (SPN23F04960) | ccrZ | 476556..477350 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=32668 SPN23F_RS02490 WP_001809846.1 472394..472543(+) (cipB) [Streptococcus pneumoniae ATCC 700669]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=32668 SPN23F_RS02490 WP_001809846.1 472394..472543(+) (cipB) [Streptococcus pneumoniae ATCC 700669]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |