Detailed information    

insolico Bioinformatically predicted

Overview

Name   dinR/lexA   Type   Regulator
Locus tag   BLCSL_RS18555 Genome accession   NZ_CP041154
Coordinates   3523485..3523703 (-) Length   72 a.a.
NCBI ID   WP_011198294.1    Uniprot ID   Q65EU9
Organism   Bacillus licheniformis strain CSL2     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context

Location: 3518485..3528703
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLCSL_RS18510 (BLCSL_18510) - 3518528..3518677 (+) 150 WP_003185290.1 YvrJ family protein -
  BLCSL_RS18515 (BLCSL_18515) - 3518771..3519925 (+) 1155 WP_003185292.1 oxalate decarboxylase family bicupin -
  BLCSL_RS18520 (BLCSL_18520) - 3519998..3520396 (+) 399 WP_003185294.1 YrvL family regulatory protein -
  BLCSL_RS18525 (BLCSL_18525) - 3520493..3520978 (+) 486 WP_003185296.1 DUF6022 family protein -
  BLCSL_RS22610 - 3521131..3521358 (+) 228 WP_003185298.1 hypothetical protein -
  BLCSL_RS18535 (BLCSL_18535) - 3521760..3522044 (+) 285 Protein_3623 hypothetical protein -
  BLCSL_RS18540 (BLCSL_18540) - 3522074..3522358 (-) 285 Protein_3624 peptidoglycan-binding protein -
  BLCSL_RS22615 - 3522779..3522931 (+) 153 WP_011198291.1 hypothetical protein -
  BLCSL_RS18550 (BLCSL_18550) - 3523095..3523454 (+) 360 WP_011198293.1 DUF4064 domain-containing protein -
  BLCSL_RS18555 (BLCSL_18555) dinR/lexA 3523485..3523703 (-) 219 WP_011198294.1 transcriptional regulator Regulator
  BLCSL_RS18560 (BLCSL_18560) - 3523924..3524736 (+) 813 WP_075223314.1 hypothetical protein -
  BLCSL_RS18565 (BLCSL_18565) - 3524826..3525194 (+) 369 WP_080618531.1 YolD-like family protein -
  BLCSL_RS18570 (BLCSL_18570) - 3525417..3526538 (-) 1122 WP_071583847.1 Rap family tetratricopeptide repeat protein -
  BLCSL_RS18575 (BLCSL_18575) - 3526794..3528317 (+) 1524 WP_071583950.1 T7SS effector LXG polymorphic toxin -
  BLCSL_RS18580 (BLCSL_18580) - 3528335..3528670 (+) 336 WP_016886588.1 hypothetical protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8231.55 Da        Isoelectric Point: 10.2439

>NTDB_id=324993 BLCSL_RS18555 WP_011198294.1 3523485..3523703(-) (dinR/lexA) [Bacillus licheniformis strain CSL2]
MKKSEQILEAIDELTKEKGFPPSVREIGERVGLKSSSTTKGHLDRLRKKGLVDWEEGKPRTLHILYKEKATI

Nucleotide


Download         Length: 219 bp        

>NTDB_id=324993 BLCSL_RS18555 WP_011198294.1 3523485..3523703(-) (dinR/lexA) [Bacillus licheniformis strain CSL2]
ATGAAAAAATCCGAACAAATATTAGAAGCCATAGACGAACTAACTAAAGAAAAAGGTTTCCCGCCATCTGTTAGGGAAAT
AGGTGAAAGGGTTGGTTTAAAATCTTCAAGTACAACAAAAGGTCATCTTGACCGGTTGCGTAAAAAGGGGCTTGTTGATT
GGGAAGAAGGTAAGCCGAGAACATTGCATATTTTGTATAAAGAAAAAGCCACCATTTAA

Domains

Predicted by InterProScan.

LexA DNA binding domain (LexA_DNA_bind)

(5-61)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q65EU9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

55.224

93.056

0.514