Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BLCSL_RS17465 | Genome accession | NZ_CP041154 |
| Coordinates | 3308789..3308929 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain CSL2 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3303789..3313929
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BLCSL_RS17440 (BLCSL_17440) | - | 3304086..3304475 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| BLCSL_RS17445 (BLCSL_17445) | comA | 3304492..3305130 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| BLCSL_RS17450 (BLCSL_17450) | comP | 3305217..3307523 (-) | 2307 | WP_025807478.1 | ATP-binding protein | Regulator |
| BLCSL_RS17455 (BLCSL_17455) | comX | 3307546..3307710 (-) | 165 | WP_003184853.1 | competence pheromone ComX | - |
| BLCSL_RS17460 (BLCSL_17460) | comQ | 3307719..3308600 (-) | 882 | WP_003184856.1 | polyprenyl synthetase family protein | Regulator |
| BLCSL_RS17465 (BLCSL_17465) | degQ | 3308789..3308929 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| BLCSL_RS17475 (BLCSL_17475) | - | 3309415..3309762 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| BLCSL_RS17480 (BLCSL_17480) | - | 3309805..3311025 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| BLCSL_RS17485 (BLCSL_17485) | - | 3311204..3312673 (-) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| BLCSL_RS17490 (BLCSL_17490) | - | 3312691..3313242 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| BLCSL_RS17495 (BLCSL_17495) | - | 3313427..3313828 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=324987 BLCSL_RS17465 WP_003184860.1 3308789..3308929(-) (degQ) [Bacillus licheniformis strain CSL2]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=324987 BLCSL_RS17465 WP_003184860.1 3308789..3308929(-) (degQ) [Bacillus licheniformis strain CSL2]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |