Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BCG9842_RS12335 | Genome accession | NC_011772 |
| Coordinates | 2480435..2480713 (+) | Length | 92 a.a. |
| NCBI ID | WP_000799078.1 | Uniprot ID | A0A9X6SNB5 |
| Organism | Bacillus cereus G9842 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2470337..2513122 | 2480435..2480713 | within | 0 |
| IScluster/Tn | 2477518..2487623 | 2480435..2480713 | within | 0 |
Gene organization within MGE regions
Location: 2470337..2513122
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BCG9842_RS12275 (BCG9842_B2737) | - | 2471033..2471344 (+) | 312 | WP_001071350.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| BCG9842_RS30990 | - | 2471497..2471628 (+) | 132 | Protein_2407 | site-specific integrase | - |
| BCG9842_RS12280 (BCG9842_B2736) | - | 2471838..2472323 (+) | 486 | WP_002082715.1 | hypothetical protein | - |
| BCG9842_RS12285 (BCG9842_B2735) | - | 2472630..2473331 (+) | 702 | WP_000736198.1 | pPIWI_RE module domain-containing protein | - |
| BCG9842_RS12290 (BCG9842_B2734) | - | 2473370..2474479 (-) | 1110 | WP_000675861.1 | tyrosine-type recombinase/integrase | - |
| BCG9842_RS12295 (BCG9842_B2733) | - | 2475024..2476175 (+) | 1152 | WP_000265314.1 | AimR family lysis-lysogeny pheromone receptor | - |
| BCG9842_RS12300 (BCG9842_B2732) | - | 2476213..2476359 (+) | 147 | WP_000720923.1 | hypothetical protein | - |
| BCG9842_RS31805 (BCG9842_B2731) | - | 2476515..2476643 (+) | 129 | WP_000836783.1 | hypothetical protein | - |
| BCG9842_RS12305 (BCG9842_B2730) | - | 2476681..2477034 (-) | 354 | WP_000491236.1 | helix-turn-helix domain-containing protein | - |
| BCG9842_RS31920 | - | 2477236..2477337 (+) | 102 | Protein_2415 | helix-turn-helix domain-containing protein | - |
| BCG9842_RS12315 (BCG9842_B2729) | tnpB | 2477518..2478639 (+) | 1122 | WP_000973259.1 | IS200/IS605 family element RNA-guided endonuclease TnpB | - |
| BCG9842_RS31605 (BCG9842_B2728) | - | 2478709..2478822 (+) | 114 | Protein_2417 | XRE family transcriptional regulator | - |
| BCG9842_RS12320 (BCG9842_B2727) | - | 2478879..2479145 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| BCG9842_RS31315 (BCG9842_B2726) | - | 2479145..2479309 (+) | 165 | WP_000390283.1 | hypothetical protein | - |
| BCG9842_RS12330 (BCG9842_B2725) | - | 2479367..2480431 (+) | 1065 | WP_001093548.1 | DnaD domain-containing protein | - |
| BCG9842_RS12335 (BCG9842_B2724) | abrB | 2480435..2480713 (+) | 279 | WP_000799078.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| BCG9842_RS12340 (BCG9842_B2723) | - | 2480706..2481065 (+) | 360 | WP_001125977.1 | hypothetical protein | - |
| BCG9842_RS29745 (BCG9842_B2722) | - | 2481085..2481249 (+) | 165 | WP_000806866.1 | DUF3954 domain-containing protein | - |
| BCG9842_RS12350 (BCG9842_B2721) | - | 2481275..2481748 (+) | 474 | WP_001272173.1 | hypothetical protein | - |
| BCG9842_RS12355 (BCG9842_B2720) | - | 2481769..2482284 (+) | 516 | WP_041488122.1 | dUTP diphosphatase | - |
| BCG9842_RS12360 | - | 2482288..2482764 (+) | 477 | WP_000679229.1 | hypothetical protein | - |
| BCG9842_RS12365 (BCG9842_B2718) | tnpB | 2483190..2484311 (+) | 1122 | WP_000973259.1 | IS200/IS605 family element RNA-guided endonuclease TnpB | - |
| BCG9842_RS12370 (BCG9842_B2717) | - | 2484441..2485043 (+) | 603 | WP_000456897.1 | hypothetical protein | - |
| BCG9842_RS12375 (BCG9842_B2716) | - | 2485671..2486243 (-) | 573 | WP_001163834.1 | cupin domain-containing protein | - |
| BCG9842_RS12380 (BCG9842_B2715) | tnpB | 2486502..2487623 (+) | 1122 | WP_000973259.1 | IS200/IS605 family element RNA-guided endonuclease TnpB | - |
| BCG9842_RS12385 (BCG9842_B2714) | - | 2487694..2488263 (+) | 570 | Protein_2431 | DUF6944 family repetitive protein | - |
| BCG9842_RS31320 (BCG9842_B2713) | - | 2488424..2488594 (+) | 171 | WP_000453402.1 | hypothetical protein | - |
| BCG9842_RS12395 (BCG9842_B2712) | - | 2488622..2489104 (+) | 483 | WP_000166176.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BCG9842_RS12400 (BCG9842_B2711) | - | 2489104..2489646 (+) | 543 | WP_001012121.1 | site-specific integrase | - |
| BCG9842_RS12410 (BCG9842_B2710) | - | 2489901..2490527 (-) | 627 | WP_000069269.1 | hypothetical protein | - |
| BCG9842_RS12415 (BCG9842_B2709) | - | 2490954..2491709 (+) | 756 | WP_000272764.1 | hypothetical protein | - |
| BCG9842_RS12420 (BCG9842_B2708) | - | 2492102..2492416 (+) | 315 | WP_000357601.1 | hypothetical protein | - |
| BCG9842_RS12425 (BCG9842_B2707) | - | 2492413..2492628 (+) | 216 | WP_000773593.1 | hypothetical protein | - |
| BCG9842_RS12430 (BCG9842_B2706) | - | 2492763..2493191 (+) | 429 | WP_000333450.1 | hypothetical protein | - |
| BCG9842_RS12435 (BCG9842_B2705) | - | 2493188..2493523 (+) | 336 | WP_000575247.1 | HNH endonuclease | - |
| BCG9842_RS12440 (BCG9842_B2704) | - | 2493517..2493738 (+) | 222 | WP_232297542.1 | hypothetical protein | - |
| BCG9842_RS12445 (BCG9842_B2703) | - | 2493907..2494212 (+) | 306 | WP_049772094.1 | hypothetical protein | - |
| BCG9842_RS12450 (BCG9842_B2702) | - | 2494209..2495864 (+) | 1656 | WP_000635290.1 | terminase TerL endonuclease subunit | - |
| BCG9842_RS12455 (BCG9842_B2701) | - | 2495870..2497033 (+) | 1164 | WP_000583777.1 | phage portal protein | - |
| BCG9842_RS12460 (BCG9842_B2700) | - | 2497017..2497799 (+) | 783 | WP_000216410.1 | head maturation protease, ClpP-related | - |
| BCG9842_RS12465 (BCG9842_B2699) | - | 2497803..2498957 (+) | 1155 | WP_000234868.1 | phage major capsid protein | - |
| BCG9842_RS12470 (BCG9842_B2698) | - | 2498963..2499256 (+) | 294 | WP_000381900.1 | hypothetical protein | - |
| BCG9842_RS12475 (BCG9842_B2697) | - | 2499258..2499611 (+) | 354 | WP_001247283.1 | phage head closure protein | - |
| BCG9842_RS12480 (BCG9842_B2696) | - | 2499613..2499954 (+) | 342 | WP_000997568.1 | HK97 gp10 family phage protein | - |
| BCG9842_RS12485 (BCG9842_B2695) | - | 2499954..2500283 (+) | 330 | WP_000172071.1 | hypothetical protein | - |
| BCG9842_RS12490 (BCG9842_B2694) | - | 2500284..2500871 (+) | 588 | WP_001004914.1 | major tail protein | - |
| BCG9842_RS12495 (BCG9842_B2693) | - | 2500876..2501238 (+) | 363 | WP_000415920.1 | hypothetical protein | - |
| BCG9842_RS31325 (BCG9842_B2692) | - | 2501292..2501453 (+) | 162 | WP_000477713.1 | hypothetical protein | - |
| BCG9842_RS12500 (BCG9842_B2691) | - | 2501469..2502677 (+) | 1209 | Protein_2454 | hypothetical protein | - |
| BCG9842_RS12505 (BCG9842_B2689) | - | 2502937..2503185 (+) | 249 | Protein_2455 | hypothetical protein | - |
| BCG9842_RS12510 (BCG9842_B2688) | - | 2503409..2505574 (+) | 2166 | WP_000180077.1 | hypothetical protein | - |
| BCG9842_RS12515 (BCG9842_B2687) | - | 2505616..2507091 (+) | 1476 | WP_000093926.1 | distal tail protein Dit | - |
| BCG9842_RS12520 (BCG9842_B2686) | - | 2507088..2511722 (+) | 4635 | WP_001275796.1 | phage tail spike protein | - |
| BCG9842_RS12525 (BCG9842_B2685) | - | 2511762..2512187 (+) | 426 | WP_000373890.1 | phage holin family protein | - |
| BCG9842_RS12530 (BCG9842_B2684) | - | 2512187..2513122 (+) | 936 | WP_000405807.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10218.83 Da Isoelectric Point: 7.1669
>NTDB_id=32407 BCG9842_RS12335 WP_000799078.1 2480435..2480713(+) (abrB) [Bacillus cereus G9842]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKQEKSCYVTGQVSESNIELLNGRMFLSKKAAIEL
LDLLQKNVTEHA
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKQEKSCYVTGQVSESNIELLNGRMFLSKKAAIEL
LDLLQKNVTEHA
Nucleotide
Download Length: 279 bp
>NTDB_id=32407 BCG9842_RS12335 WP_000799078.1 2480435..2480713(+) (abrB) [Bacillus cereus G9842]
ATGAAAAACACGGGCGTCGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATCCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCCGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATTGTTTTAAGAAAACAAGAAAAGTCATGCTATG
TAACGGGTCAAGTGTCTGAATCCAACATTGAATTGTTAAATGGGCGAATGTTTTTGAGTAAGAAAGCTGCAATCGAGTTA
CTGGACCTCCTTCAAAAGAATGTGACGGAACATGCCTAA
ATGAAAAACACGGGCGTCGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATCCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCCGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATTGTTTTAAGAAAACAAGAAAAGTCATGCTATG
TAACGGGTCAAGTGTCTGAATCCAACATTGAATTGTTAAATGGGCGAATGTTTTTGAGTAAGAAAGCTGCAATCGAGTTA
CTGGACCTCCTTCAAAAGAATGTGACGGAACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
55.172 |
94.565 |
0.522 |