Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EEB07_RS01770 | Genome accession | NZ_CP033576 |
| Coordinates | 355718..355891 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain NY12-2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 350718..360891
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EEB07_RS01755 (EEB07_01755) | gcvT | 351531..352631 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| EEB07_RS01760 (EEB07_01760) | - | 353055..354725 (+) | 1671 | WP_017418135.1 | SNF2-related protein | - |
| EEB07_RS01765 (EEB07_01765) | - | 354747..355541 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| EEB07_RS01770 (EEB07_01770) | sinI | 355718..355891 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| EEB07_RS01775 (EEB07_01775) | sinR | 355925..356260 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| EEB07_RS01780 (EEB07_01780) | - | 356308..357093 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| EEB07_RS01785 (EEB07_01785) | - | 357158..357742 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| EEB07_RS01790 (EEB07_01790) | tapA | 357714..358385 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EEB07_RS01795 (EEB07_01795) | - | 358644..358973 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| EEB07_RS01800 (EEB07_01800) | - | 359014..359193 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| EEB07_RS01805 (EEB07_01805) | comGG | 359250..359627 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| EEB07_RS01810 (EEB07_01810) | comGF | 359628..360023 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| EEB07_RS01815 (EEB07_01815) | comGE | 360037..360351 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| EEB07_RS01820 (EEB07_01820) | comGD | 360335..360772 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=324021 EEB07_RS01770 WP_014418369.1 355718..355891(+) (sinI) [Bacillus velezensis strain NY12-2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=324021 EEB07_RS01770 WP_014418369.1 355718..355891(+) (sinI) [Bacillus velezensis strain NY12-2]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |