Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D5285_RS13645 | Genome accession | NZ_CP033389 |
| Coordinates | 2707991..2708167 (+) | Length | 58 a.a. |
| NCBI ID | WP_020452165.1 | Uniprot ID | - |
| Organism | Bacillus paralicheniformis strain CBMAI 1303 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2702991..2713167
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D5285_RS13625 (D5285_13625) | gcvT | 2703631..2704725 (-) | 1095 | WP_020452162.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D5285_RS13635 (D5285_13635) | - | 2705320..2706999 (+) | 1680 | WP_020452163.1 | DEAD/DEAH box helicase | - |
| D5285_RS13640 (D5285_13640) | - | 2707006..2707800 (+) | 795 | WP_020452164.1 | YqhG family protein | - |
| D5285_RS13645 (D5285_13645) | sinI | 2707991..2708167 (+) | 177 | WP_020452165.1 | anti-repressor SinI | Regulator |
| D5285_RS13650 (D5285_13650) | sinR | 2708201..2708536 (+) | 336 | WP_023855185.1 | transcriptional regulator SinR | Regulator |
| D5285_RS13655 (D5285_13655) | tasA | 2708641..2709435 (-) | 795 | WP_020452167.1 | biofilm matrix protein TasA | - |
| D5285_RS13660 (D5285_13660) | sipW | 2709508..2710092 (-) | 585 | WP_020452168.1 | signal peptidase I SipW | - |
| D5285_RS13665 (D5285_13665) | tapA | 2710089..2710817 (-) | 729 | WP_020452169.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D5285_RS13670 (D5285_13670) | - | 2711095..2711415 (+) | 321 | WP_020452170.1 | YqzG/YhdC family protein | - |
| D5285_RS13675 (D5285_13675) | - | 2711445..2711627 (-) | 183 | WP_020452171.1 | YqzE family protein | - |
| D5285_RS13680 (D5285_13680) | comGG | 2711716..2712081 (-) | 366 | WP_020452172.1 | competence type IV pilus minor pilin ComGG | - |
| D5285_RS13685 (D5285_13685) | comGF | 2712093..2712581 (-) | 489 | WP_236613657.1 | competence type IV pilus minor pilin ComGF | - |
| D5285_RS13690 (D5285_13690) | comGE | 2712490..2712837 (-) | 348 | WP_020452174.1 | competence type IV pilus minor pilin ComGE | - |
Sequence
Protein
Download Length: 58 a.a. Molecular weight: 6694.49 Da Isoelectric Point: 5.0637
>NTDB_id=323568 D5285_RS13645 WP_020452165.1 2707991..2708167(+) (sinI) [Bacillus paralicheniformis strain CBMAI 1303]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF
Nucleotide
Download Length: 177 bp
>NTDB_id=323568 D5285_RS13645 WP_020452165.1 2707991..2708167(+) (sinI) [Bacillus paralicheniformis strain CBMAI 1303]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
50 |
100 |
0.5 |