Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DA787_RS12375 Genome accession   NZ_CP033205
Coordinates   2411329..2411502 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MBI 600     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2406329..2416502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA787_RS12360 (DA787_12345) gcvT 2407128..2408216 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  DA787_RS12365 (DA787_12350) hepAA 2408658..2410331 (+) 1674 WP_004398544.1 SNF2-related protein -
  DA787_RS12370 (DA787_12355) yqhG 2410352..2411146 (+) 795 WP_003230200.1 YqhG family protein -
  DA787_RS12375 (DA787_12360) sinI 2411329..2411502 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DA787_RS12380 (DA787_12365) sinR 2411536..2411871 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DA787_RS12385 (DA787_12370) tasA 2411964..2412749 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  DA787_RS12390 (DA787_12375) sipW 2412813..2413385 (-) 573 WP_003246088.1 signal peptidase I SipW -
  DA787_RS12395 (DA787_12380) tapA 2413369..2414130 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  DA787_RS12400 (DA787_12385) yqzG 2414402..2414728 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DA787_RS12405 (DA787_12390) spoIITA 2414770..2414949 (-) 180 WP_003230176.1 YqzE family protein -
  DA787_RS12410 (DA787_12395) comGG 2415020..2415394 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  DA787_RS12415 (DA787_12400) comGF 2415395..2415778 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  DA787_RS12420 (DA787_12405) comGE 2415804..2416151 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=322558 DA787_RS12375 WP_003230187.1 2411329..2411502(+) (sinI) [Bacillus subtilis strain MBI 600]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=322558 DA787_RS12375 WP_003230187.1 2411329..2411502(+) (sinI) [Bacillus subtilis strain MBI 600]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment