Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D2B33_RS02720 Genome accession   NZ_CP033198
Coordinates   543432..543572 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain FA6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 538432..548572
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D2B33_RS02695 (D2B33_02710) - 538533..538934 (+) 402 WP_039072963.1 YueI family protein -
  D2B33_RS02700 (D2B33_02715) - 539120..539671 (+) 552 WP_020452795.1 cysteine hydrolase family protein -
  D2B33_RS02705 (D2B33_02720) - 539749..541158 (+) 1410 WP_235442597.1 nicotinate phosphoribosyltransferase -
  D2B33_RS02710 (D2B33_02725) - 541336..542556 (+) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  D2B33_RS02715 (D2B33_02730) - 542599..542946 (-) 348 WP_223254849.1 hypothetical protein -
  D2B33_RS02720 (D2B33_02740) degQ 543432..543572 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  D2B33_RS02725 (D2B33_02745) - 543759..544670 (+) 912 WP_020452791.1 polyprenyl synthetase family protein -
  D2B33_RS02730 (D2B33_02750) comX 544642..544812 (+) 171 WP_020452790.1 competence pheromone ComX -
  D2B33_RS02735 (D2B33_02755) - 544941..545651 (+) 711 WP_183163973.1 hypothetical protein -
  D2B33_RS02740 (D2B33_02760) - 545645..546238 (-) 594 WP_020452312.1 TetR/AcrR family transcriptional regulator -
  D2B33_RS02745 (D2B33_02765) - 546327..547037 (+) 711 WP_020452313.1 GAP family protein -
  D2B33_RS02750 (D2B33_02770) - 547069..547281 (+) 213 WP_040037657.1 hypothetical protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=322422 D2B33_RS02720 WP_003184860.1 543432..543572(+) (degQ) [Bacillus paralicheniformis strain FA6]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=322422 D2B33_RS02720 WP_003184860.1 543432..543572(+) (degQ) [Bacillus paralicheniformis strain FA6]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment