Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FC605_RS16140 Genome accession   NZ_CP040528
Coordinates   3107624..3107764 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PR10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3102624..3112764
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FC605_RS16115 (FC605_16115) yuxO 3102952..3103332 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  FC605_RS16120 (FC605_16120) comA 3103351..3103995 (-) 645 WP_080529735.1 two-component system response regulator ComA Regulator
  FC605_RS16125 (FC605_16125) comP 3104076..3106337 (-) 2262 WP_080529736.1 histidine kinase Regulator
  FC605_RS16130 (FC605_16130) comX 3106353..3106574 (-) 222 WP_014480704.1 competence pheromone ComX -
  FC605_RS16135 (FC605_16135) comQ 3106576..3107439 (-) 864 WP_080529737.1 polyprenyl synthetase family protein Regulator
  FC605_RS16140 (FC605_16140) degQ 3107624..3107764 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  FC605_RS16145 (FC605_16145) - 3107986..3108111 (+) 126 WP_003228793.1 hypothetical protein -
  FC605_RS16150 (FC605_16150) - 3108226..3108594 (+) 369 WP_014477834.1 hypothetical protein -
  FC605_RS16155 (FC605_16155) pdeH 3108570..3109799 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  FC605_RS16160 (FC605_16160) pncB 3109936..3111408 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  FC605_RS16165 (FC605_16165) pncA 3111424..3111975 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  FC605_RS16170 (FC605_16170) yueI 3112072..3112470 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=321963 FC605_RS16140 WP_003220708.1 3107624..3107764(-) (degQ) [Bacillus subtilis strain PR10]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=321963 FC605_RS16140 WP_003220708.1 3107624..3107764(-) (degQ) [Bacillus subtilis strain PR10]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment