Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BCB4264_RS12815 | Genome accession | NC_011725 |
| Coordinates | 2517604..2517882 (+) | Length | 92 a.a. |
| NCBI ID | WP_000799096.1 | Uniprot ID | B7H5R2 |
| Organism | Bacillus cereus B4264 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2507451..2553446 | 2517604..2517882 | within | 0 |
Gene organization within MGE regions
Location: 2507451..2553446
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BCB4264_RS12740 (BCB4264_A2585) | - | 2507451..2507714 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| BCB4264_RS12745 (BCB4264_A2586) | - | 2508272..2508592 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| BCB4264_RS29120 | - | 2508738..2508872 (+) | 135 | Protein_2425 | site-specific integrase | - |
| BCB4264_RS12750 (BCB4264_A2587) | - | 2509082..2509567 (+) | 486 | WP_041183984.1 | hypothetical protein | - |
| BCB4264_RS12755 (BCB4264_A2588) | - | 2509876..2510577 (+) | 702 | WP_000736186.1 | DUF3962 domain-containing protein | - |
| BCB4264_RS12760 (BCB4264_A2589) | - | 2510616..2511725 (-) | 1110 | WP_000675857.1 | tyrosine-type recombinase/integrase | - |
| BCB4264_RS12765 (BCB4264_A2591) | - | 2512480..2513688 (+) | 1209 | WP_001197709.1 | AimR family lysis-lysogeny pheromone receptor | - |
| BCB4264_RS29125 (BCB4264_A2592) | - | 2513715..2513870 (+) | 156 | WP_000791664.1 | hypothetical protein | - |
| BCB4264_RS12775 (BCB4264_A2593) | - | 2514131..2514481 (-) | 351 | WP_000425256.1 | helix-turn-helix transcriptional regulator | - |
| BCB4264_RS12780 (BCB4264_A2594) | - | 2514664..2514960 (+) | 297 | WP_001180929.1 | helix-turn-helix transcriptional regulator | - |
| BCB4264_RS29750 | - | 2515016..2515117 (+) | 102 | Protein_2433 | ORF6C domain-containing protein | - |
| BCB4264_RS12785 (BCB4264_A2595) | - | 2515176..2515442 (+) | 267 | WP_000522024.1 | helix-turn-helix domain-containing protein | - |
| BCB4264_RS29380 | - | 2515442..2515606 (+) | 165 | WP_000390298.1 | hypothetical protein | - |
| BCB4264_RS29385 (BCB4264_A2596) | - | 2515636..2515812 (+) | 177 | WP_000281548.1 | hypothetical protein | - |
| BCB4264_RS12800 (BCB4264_A2597) | - | 2515817..2516563 (+) | 747 | WP_000190249.1 | DnaD domain protein | - |
| BCB4264_RS12805 (BCB4264_A2598) | - | 2516502..2517377 (+) | 876 | WP_000235016.1 | ATP-binding protein | - |
| BCB4264_RS12810 (BCB4264_A2599) | - | 2517393..2517587 (+) | 195 | WP_000337979.1 | hypothetical protein | - |
| BCB4264_RS12815 (BCB4264_A2600) | abrB | 2517604..2517882 (+) | 279 | WP_000799096.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| BCB4264_RS12820 (BCB4264_A2601) | - | 2517875..2518234 (+) | 360 | WP_001125968.1 | hypothetical protein | - |
| BCB4264_RS12825 (BCB4264_A2602) | - | 2518253..2518420 (+) | 168 | WP_000717828.1 | DUF3954 domain-containing protein | - |
| BCB4264_RS12830 (BCB4264_A2603) | - | 2518447..2518698 (+) | 252 | WP_000109494.1 | hypothetical protein | - |
| BCB4264_RS12835 (BCB4264_A2604) | - | 2518718..2519200 (+) | 483 | WP_001024290.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| BCB4264_RS12840 (BCB4264_A2605) | - | 2519238..2519453 (+) | 216 | WP_000260124.1 | hypothetical protein | - |
| BCB4264_RS29390 (BCB4264_A2606) | - | 2519443..2519616 (+) | 174 | WP_000444024.1 | hypothetical protein | - |
| BCB4264_RS12845 (BCB4264_A2607) | - | 2519888..2520460 (-) | 573 | WP_001163832.1 | cupin domain-containing protein | - |
| BCB4264_RS29395 (BCB4264_A2608) | - | 2522741..2522905 (-) | 165 | WP_001113467.1 | hypothetical protein | - |
| BCB4264_RS12855 (BCB4264_A2609) | - | 2523034..2523156 (+) | 123 | WP_000183173.1 | DUF3983 domain-containing protein | - |
| BCB4264_RS12860 (BCB4264_A2610) | - | 2523177..2523365 (+) | 189 | WP_001013577.1 | hypothetical protein | - |
| BCB4264_RS29400 (BCB4264_A2611) | - | 2523464..2523634 (+) | 171 | WP_000677276.1 | hypothetical protein | - |
| BCB4264_RS12870 (BCB4264_A2612) | - | 2523662..2524144 (+) | 483 | WP_000166186.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BCB4264_RS12875 (BCB4264_A2613) | - | 2524144..2524686 (+) | 543 | WP_001012135.1 | site-specific integrase | - |
| BCB4264_RS12880 (BCB4264_A2614) | - | 2524898..2525848 (+) | 951 | WP_001170296.1 | nucleoside hydrolase | - |
| BCB4264_RS12885 (BCB4264_A2615) | - | 2526616..2526795 (+) | 180 | WP_001048953.1 | hypothetical protein | - |
| BCB4264_RS12890 (BCB4264_A2616) | - | 2526885..2527751 (+) | 867 | WP_001050327.1 | hypothetical protein | - |
| BCB4264_RS12895 (BCB4264_A2617) | - | 2527800..2528012 (+) | 213 | WP_001044244.1 | hypothetical protein | - |
| BCB4264_RS12900 (BCB4264_A2618) | - | 2528154..2528408 (+) | 255 | WP_001198494.1 | hypothetical protein | - |
| BCB4264_RS12905 (BCB4264_A2619) | - | 2528398..2528775 (+) | 378 | WP_001139459.1 | HNH endonuclease | - |
| BCB4264_RS12910 (BCB4264_A2620) | - | 2528904..2529407 (+) | 504 | WP_000251640.1 | phage terminase small subunit P27 family | - |
| BCB4264_RS12915 (BCB4264_A2621) | - | 2529409..2531103 (+) | 1695 | WP_000621126.1 | terminase TerL endonuclease subunit | - |
| BCB4264_RS12920 (BCB4264_A2622) | - | 2531292..2532545 (+) | 1254 | WP_000577424.1 | phage portal protein | - |
| BCB4264_RS12925 (BCB4264_A2623) | - | 2532532..2533242 (+) | 711 | WP_001259165.1 | head maturation protease, ClpP-related | - |
| BCB4264_RS12930 (BCB4264_A2624) | - | 2533280..2534452 (+) | 1173 | WP_000357562.1 | phage major capsid protein | - |
| BCB4264_RS12935 (BCB4264_A2625) | - | 2534473..2534760 (+) | 288 | WP_000244589.1 | head-tail connector protein | - |
| BCB4264_RS12940 (BCB4264_A2626) | - | 2534747..2535070 (+) | 324 | WP_001068025.1 | phage head closure protein | - |
| BCB4264_RS12945 (BCB4264_A2627) | - | 2535063..2535497 (+) | 435 | WP_000785254.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BCB4264_RS12950 (BCB4264_A2628) | - | 2535494..2535853 (+) | 360 | WP_000981497.1 | DUF3168 domain-containing protein | - |
| BCB4264_RS12955 (BCB4264_A2629) | - | 2535854..2536459 (+) | 606 | WP_000896776.1 | major tail protein | - |
| BCB4264_RS12960 (BCB4264_A2630) | - | 2536509..2536826 (+) | 318 | WP_000779162.1 | hypothetical protein | - |
| BCB4264_RS29130 | - | 2536856..2537032 (+) | 177 | WP_000344056.1 | hypothetical protein | - |
| BCB4264_RS12965 (BCB4264_A2632) | - | 2537048..2540899 (+) | 3852 | WP_001262731.1 | phage tail tape measure protein | - |
| BCB4264_RS12970 (BCB4264_A2633) | - | 2540914..2542395 (+) | 1482 | WP_000517342.1 | distal tail protein Dit | - |
| BCB4264_RS12975 (BCB4264_A2634) | - | 2542392..2546423 (+) | 4032 | WP_001260177.1 | phage tail spike protein | - |
| BCB4264_RS12980 (BCB4264_A2635) | - | 2546454..2546705 (+) | 252 | WP_041184031.1 | hemolysin XhlA family protein | - |
| BCB4264_RS12985 (BCB4264_A2636) | - | 2546748..2546978 (+) | 231 | WP_001243422.1 | phage holin | - |
| BCB4264_RS12990 (BCB4264_A2637) | - | 2546995..2547930 (+) | 936 | WP_000405806.1 | N-acetylmuramoyl-L-alanine amidase | - |
| BCB4264_RS12995 (BCB4264_A2638) | - | 2547996..2548331 (-) | 336 | WP_041184032.1 | YolD-like family protein | - |
| BCB4264_RS28260 | - | 2548644..2548831 (-) | 188 | Protein_2479 | DDE-type integrase/transposase/recombinase | - |
| BCB4264_RS28265 | - | 2548860..2549087 (-) | 228 | WP_071740181.1 | DUF3947 family protein | - |
| BCB4264_RS13000 (BCB4264_A2639) | - | 2549503..2550213 (-) | 711 | WP_001289205.1 | DUF421 domain-containing protein | - |
| BCB4264_RS13005 (BCB4264_A2640) | - | 2550824..2551240 (+) | 417 | WP_001061493.1 | DUF1259 domain-containing protein | - |
| BCB4264_RS13010 (BCB4264_A2641) | - | 2551953..2553446 (+) | 1494 | WP_000357181.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10012.54 Da Isoelectric Point: 6.4652
>NTDB_id=32079 BCB4264_RS12815 WP_000799096.1 2517604..2517882(+) (abrB) [Bacillus cereus B4264]
MKNTGVSRKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LNFIQKSGLADA
MKNTGVSRKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LNFIQKSGLADA
Nucleotide
Download Length: 279 bp
>NTDB_id=32079 BCB4264_RS12815 WP_000799096.1 2517604..2517882(+) (abrB) [Bacillus cereus B4264]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAATAGAGTTACGTAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGAATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAATAGAGTTACGTAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGAATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
60.92 |
94.565 |
0.576 |