Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   D9C18_RS18905 Genome accession   NZ_CP032865
Coordinates   3553617..3554027 (+) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis subsp. subtilis strain N3-1     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3530731..3558660 3553617..3554027 within 0


Gene organization within MGE regions


Location: 3530731..3558660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C18_RS18745 (D9C18_18745) - 3530731..3530911 (+) 181 Protein_3614 hypothetical protein -
  D9C18_RS23090 - 3531220..3531450 (+) 231 WP_224588644.1 hypothetical protein -
  D9C18_RS18755 (D9C18_18755) - 3531595..3531843 (+) 249 Protein_3616 hypothetical protein -
  D9C18_RS18760 (D9C18_18760) - 3531806..3531928 (+) 123 Protein_3617 RusA family crossover junction endodeoxyribonuclease -
  D9C18_RS18765 (D9C18_18765) - 3532011..3532163 (+) 153 WP_049832653.1 XtrA/YqaO family protein -
  D9C18_RS18770 (D9C18_18770) - 3532302..3532568 (-) 267 WP_033881358.1 hypothetical protein -
  D9C18_RS18775 (D9C18_18775) - 3533185..3533664 (+) 480 WP_014480344.1 hypothetical protein -
  D9C18_RS23095 - 3533819..3533884 (+) 66 Protein_3621 hypothetical protein -
  D9C18_RS22715 - 3534057..3534362 (-) 306 WP_123772463.1 hypothetical protein -
  D9C18_RS22790 terS 3534489..3535054 (+) 566 Protein_3623 phage terminase small subunit -
  D9C18_RS18785 (D9C18_18785) - 3535052..3535488 (+) 437 Protein_3624 phage tail tube protein -
  D9C18_RS18790 (D9C18_18790) - 3535775..3535861 (-) 87 WP_072592549.1 putative holin-like toxin -
  D9C18_RS23100 - 3536039..3536136 (+) 98 Protein_3626 N-acetylmuramoyl-L-alanine amidase -
  D9C18_RS18800 (D9C18_18800) istB 3536454..3537212 (-) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  D9C18_RS18805 (D9C18_18805) istA 3537209..3538756 (-) 1548 WP_014480339.1 IS21 family transposase -
  D9C18_RS18815 (D9C18_18815) - 3539597..3539887 (-) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  D9C18_RS18820 (D9C18_18820) atxG 3539997..3540574 (-) 578 Protein_3630 suppressor of fused domain protein -
  D9C18_RS18825 (D9C18_18825) - 3540842..3541075 (-) 234 WP_224588641.1 hypothetical protein -
  D9C18_RS22720 - 3541164..3541367 (+) 204 WP_123772462.1 hypothetical protein -
  D9C18_RS18830 (D9C18_18830) - 3541675..3542154 (-) 480 WP_224588637.1 hypothetical protein -
  D9C18_RS18835 (D9C18_18835) cdiI 3542259..3542618 (-) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  D9C18_RS18840 (D9C18_18840) - 3542715..3543167 (-) 453 WP_014480333.1 SMI1/KNR4 family protein -
  D9C18_RS18845 (D9C18_18845) - 3543266..3543706 (-) 441 WP_014480332.1 SMI1/KNR4 family protein -
  D9C18_RS18855 (D9C18_18855) - 3544109..3544396 (-) 288 WP_014480331.1 hypothetical protein -
  D9C18_RS23210 (D9C18_18860) - 3544410..3546336 (-) 1927 Protein_3638 T7SS effector LXG polymorphic toxin -
  D9C18_RS18865 (D9C18_18865) - 3546518..3547645 (+) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  D9C18_RS18875 (D9C18_18875) - 3548385..3548780 (-) 396 WP_014480327.1 VOC family protein -
  D9C18_RS18880 (D9C18_18880) - 3549722..3550612 (-) 891 WP_014480326.1 LysR family transcriptional regulator -
  D9C18_RS18885 (D9C18_18885) fumC 3550779..3552167 (+) 1389 WP_014480325.1 class II fumarate hydratase -
  D9C18_RS23120 - 3552386..3552598 (+) 213 Protein_3643 recombinase family protein -
  D9C18_RS18895 (D9C18_18895) - 3552595..3552693 (-) 99 WP_031600702.1 hypothetical protein -
  D9C18_RS18900 (D9C18_18900) sigK 3552693..3553421 (-) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  D9C18_RS18905 (D9C18_18905) nucA/comI 3553617..3554027 (+) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  D9C18_RS18910 (D9C18_18910) yqeB 3554060..3554782 (-) 723 WP_014480321.1 hypothetical protein -
  D9C18_RS18915 (D9C18_18915) gnd 3555033..3555926 (+) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  D9C18_RS18920 (D9C18_18920) yqeD 3555945..3556571 (-) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  D9C18_RS18925 (D9C18_18925) cwlH 3556758..3557510 (+) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  D9C18_RS18930 (D9C18_18930) yqeF 3557762..3558493 (+) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=319748 D9C18_RS18905 WP_009967785.1 3553617..3554027(+) (nucA/comI) [Bacillus subtilis subsp. subtilis strain N3-1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=319748 D9C18_RS18905 WP_009967785.1 3553617..3554027(+) (nucA/comI) [Bacillus subtilis subsp. subtilis strain N3-1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment