Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   D9C17_RS06575 Genome accession   NZ_CP032863
Coordinates   1185802..1185942 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain N2-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1180802..1190942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C17_RS06550 (D9C17_06550) yuxO 1181079..1181459 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  D9C17_RS06555 (D9C17_06555) comA 1181478..1182122 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C17_RS06560 (D9C17_06560) comP 1182203..1184515 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  D9C17_RS06565 (D9C17_06565) comX 1184531..1184752 (-) 222 WP_014480704.1 competence pheromone ComX -
  D9C17_RS06570 (D9C17_06570) - 1184754..1185617 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  D9C17_RS06575 (D9C17_06575) degQ 1185802..1185942 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C17_RS06580 (D9C17_06580) - 1186164..1186289 (+) 126 WP_003228793.1 hypothetical protein -
  D9C17_RS06585 (D9C17_06585) - 1186403..1186771 (+) 369 WP_014477834.1 hypothetical protein -
  D9C17_RS06590 (D9C17_06590) pdeH 1186747..1187976 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  D9C17_RS06595 (D9C17_06595) pncB 1188112..1189584 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  D9C17_RS06600 (D9C17_06600) pncA 1189600..1190151 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  D9C17_RS06605 (D9C17_06605) yueI 1190248..1190646 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=319635 D9C17_RS06575 WP_003220708.1 1185802..1185942(-) (degQ) [Bacillus subtilis subsp. subtilis strain N2-2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=319635 D9C17_RS06575 WP_003220708.1 1185802..1185942(-) (degQ) [Bacillus subtilis subsp. subtilis strain N2-2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment