Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | D9C16_RS00470 | Genome accession | NZ_CP032861 |
| Coordinates | 74306..74716 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis subsp. subtilis strain N1-1 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 50393..79348 | 74306..74716 | within | 0 |
Gene organization within MGE regions
Location: 50393..79348
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C16_RS00305 (D9C16_00305) | bltR | 50393..51214 (+) | 822 | WP_014480349.1 | multidrug efflux transcriptional regulator BltR | - |
| D9C16_RS00310 (D9C16_00310) | - | 51422..51602 (+) | 181 | Protein_61 | hypothetical protein | - |
| D9C16_RS22700 | - | 51911..52141 (+) | 231 | WP_224588644.1 | hypothetical protein | - |
| D9C16_RS00320 (D9C16_00320) | - | 52286..52534 (+) | 249 | Protein_63 | hypothetical protein | - |
| D9C16_RS00325 (D9C16_00325) | - | 52497..52619 (+) | 123 | Protein_64 | RusA family crossover junction endodeoxyribonuclease | - |
| D9C16_RS00330 (D9C16_00330) | - | 52702..52854 (+) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| D9C16_RS00335 (D9C16_00335) | - | 52993..53259 (-) | 267 | WP_033881358.1 | hypothetical protein | - |
| D9C16_RS00340 (D9C16_00340) | - | 53876..54355 (+) | 480 | WP_014480344.1 | hypothetical protein | - |
| D9C16_RS22705 | - | 54510..54575 (+) | 66 | Protein_68 | hypothetical protein | - |
| D9C16_RS22475 | - | 54748..55053 (-) | 306 | WP_123772463.1 | hypothetical protein | - |
| D9C16_RS22655 | terS | 55180..55745 (+) | 566 | Protein_70 | phage terminase small subunit | - |
| D9C16_RS00350 (D9C16_00350) | - | 55743..56179 (+) | 437 | Protein_71 | phage tail tube protein | - |
| D9C16_RS00355 (D9C16_00355) | - | 56466..56552 (-) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| D9C16_RS22710 | - | 56730..56827 (+) | 98 | Protein_73 | N-acetylmuramoyl-L-alanine amidase | - |
| D9C16_RS00365 (D9C16_00365) | istB | 57145..57903 (-) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| D9C16_RS00370 (D9C16_00370) | istA | 57900..59447 (-) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| D9C16_RS00380 (D9C16_00380) | - | 60288..60578 (-) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| D9C16_RS00385 (D9C16_00385) | atxG | 60688..61265 (-) | 578 | Protein_77 | suppressor of fused domain protein | - |
| D9C16_RS00390 (D9C16_00390) | - | 61533..61766 (-) | 234 | WP_224588641.1 | hypothetical protein | - |
| D9C16_RS22480 | - | 61855..62058 (+) | 204 | WP_123772462.1 | hypothetical protein | - |
| D9C16_RS00395 (D9C16_00395) | - | 62366..62878 (-) | 513 | WP_014477426.1 | hypothetical protein | - |
| D9C16_RS00400 (D9C16_00400) | cdiI | 62950..63309 (-) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| D9C16_RS00405 (D9C16_00405) | - | 63406..63858 (-) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| D9C16_RS00410 (D9C16_00410) | - | 63957..64397 (-) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| D9C16_RS00420 (D9C16_00420) | - | 64800..65087 (-) | 288 | WP_014480331.1 | hypothetical protein | - |
| D9C16_RS23045 (D9C16_00425) | - | 65101..67027 (-) | 1927 | Protein_85 | T7SS effector LXG polymorphic toxin | - |
| D9C16_RS00430 (D9C16_00430) | - | 67209..68336 (+) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| D9C16_RS00440 (D9C16_00440) | - | 69075..69470 (-) | 396 | WP_014480327.1 | VOC family protein | - |
| D9C16_RS00445 (D9C16_00445) | - | 70412..71302 (-) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| D9C16_RS00450 (D9C16_00450) | fumC | 71469..72856 (+) | 1388 | Protein_89 | class II fumarate hydratase | - |
| D9C16_RS22730 | - | 73075..73287 (+) | 213 | Protein_90 | recombinase family protein | - |
| D9C16_RS00460 (D9C16_00460) | - | 73284..73382 (-) | 99 | WP_031600702.1 | hypothetical protein | - |
| D9C16_RS00465 (D9C16_00465) | sigK | 73382..74110 (-) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| D9C16_RS00470 (D9C16_00470) | nucA/comI | 74306..74716 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| D9C16_RS00475 (D9C16_00475) | yqeB | 74749..75471 (-) | 723 | WP_014480321.1 | hypothetical protein | - |
| D9C16_RS00480 (D9C16_00480) | gnd | 75722..76614 (+) | 893 | Protein_95 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| D9C16_RS00485 (D9C16_00485) | yqeD | 76633..77259 (-) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| D9C16_RS00490 (D9C16_00490) | cwlH | 77446..78198 (+) | 753 | WP_014480318.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| D9C16_RS00495 (D9C16_00495) | yqeF | 78450..79181 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=319531 D9C16_RS00470 WP_009967785.1 74306..74716(+) (nucA/comI) [Bacillus subtilis subsp. subtilis strain N1-1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=319531 D9C16_RS00470 WP_009967785.1 74306..74716(+) (nucA/comI) [Bacillus subtilis subsp. subtilis strain N1-1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |